(data stored in ACNUC7421 zone)

EMBL: BA000030.PE132

BA000030.PE132       Location/Qualifiers
FT   CDS             148993..149274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_132"
FT                   /old_locus_tag="SAV_132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_132"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67841"
FT                   /db_xref="GOA:Q82RL1"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RL1"
FT                   /protein_id="BAC67841.1"
FT                   /translation="MTIPHSHGRTCADHATHWLRRRLGRAVALAYLAAVLLPGPGRWLR
FT                   HTHTLVGTGLPLYTASLLLSLVLFSAGLQVPVRALGQLLRRPRACWQG"
     MTIPHSHGRT CADHATHWLR RRLGRAVALA YLAAVLLPGP GRWLRHTHTL VGTGLPLYTA        60
     SLLLSLVLFS AGLQVPVRAL GQLLRRPRAC WQG                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page