(data stored in ACNUC7421 zone)

EMBL: BA000030.PE138

BA000030.PE138       Location/Qualifiers
FT   CDS             153715..156363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_138"
FT                   /old_locus_tag="SAV_138"
FT                   /product="putative ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_138"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67847"
FT                   /db_xref="GOA:Q82RK5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RK5"
FT                   /protein_id="BAC67847.1"
FT                   /translation="MNTAWAGGLARHRAGRLLAALAGIALAVALVAALGSFLTVSKATM
FT                   TQRAVRSVAVDWQVEVQPGADPQAMLSLVRKAPGIRTAVPVGFAHSSAFTAQVQGSTQT
FT                   TGPGMVLGLPDGYQKLFPGGIRPLTGGTSGVLLAQQTASNLHVAPGDTVGIRLPGTGVR
FT                   QVRVAGVVDLPQADSLFQKVGAPTQSQPTAPPDNVVLLPSTTFTSLTAQAPAAGVTTQI
FT                   HAARDAKLPSEPAAAFNTATRGAHNLEARASGAAIVGNNLGAALDSARQDALYAQILFL
FT                   FLGVPGALLAAALTAAVAAAGGERRRQEQALLRLRGLRPGRIATLSGIEAGLVGAGGAA
FT                   AGLGIAALLGRLAFGSASFGTSAGTWILWYALAFVLGAVVAAGAVLVPALRDLRGVTVA
FT                   DTRRAGRRTGSVWWMRYGVDFALLIGSWLIFRASSGNQYALVLAPEGVPSISVSYWAFL
FT                   GPALLWIGSALLLWRLTLLALTHGRRVLARLSLPLAKNLAGTTAAVLSRRRRPLARSVV
FT                   LLALAVSFAISTATFNATYKQQAEVDARLTNGADVTVTEPPEARTPPGAAASLKVSGVR
FT                   HVEALQHRFAYVGSDLQDLYGVRPDTITSATSLQDAYFSGGTAGTLMRKLAKQPDALLV
FT                   SAETVTDFQLSPGDTVNLRIQDAHTKALRTVPFHYVGVAKEFPTAPKDSFFVANASYVA
FT                   QATGSDSVGAFLLDTGGTHQKQIAAHLRRQLGTSATVSDLTQTRGTVGSSLTAVDLAGL
FT                   TRIELAFAVLLAAGAGGLVLALGLAERRRTFAIATVLGATRRQLRGMVLTEAILLTAGG
FT                   LAGGALIGWALSEMLVKVLTGVFDPPPADLAVPGAYLALTAFAATVAVLAAALNGVRRA
FT                   ARPAVEELRDL"
     MNTAWAGGLA RHRAGRLLAA LAGIALAVAL VAALGSFLTV SKATMTQRAV RSVAVDWQVE        60
     VQPGADPQAM LSLVRKAPGI RTAVPVGFAH SSAFTAQVQG STQTTGPGMV LGLPDGYQKL       120
     FPGGIRPLTG GTSGVLLAQQ TASNLHVAPG DTVGIRLPGT GVRQVRVAGV VDLPQADSLF       180
     QKVGAPTQSQ PTAPPDNVVL LPSTTFTSLT AQAPAAGVTT QIHAARDAKL PSEPAAAFNT       240
     ATRGAHNLEA RASGAAIVGN NLGAALDSAR QDALYAQILF LFLGVPGALL AAALTAAVAA       300
     AGGERRRQEQ ALLRLRGLRP GRIATLSGIE AGLVGAGGAA AGLGIAALLG RLAFGSASFG       360
     TSAGTWILWY ALAFVLGAVV AAGAVLVPAL RDLRGVTVAD TRRAGRRTGS VWWMRYGVDF       420
     ALLIGSWLIF RASSGNQYAL VLAPEGVPSI SVSYWAFLGP ALLWIGSALL LWRLTLLALT       480
     HGRRVLARLS LPLAKNLAGT TAAVLSRRRR PLARSVVLLA LAVSFAISTA TFNATYKQQA       540
     EVDARLTNGA DVTVTEPPEA RTPPGAAASL KVSGVRHVEA LQHRFAYVGS DLQDLYGVRP       600
     DTITSATSLQ DAYFSGGTAG TLMRKLAKQP DALLVSAETV TDFQLSPGDT VNLRIQDAHT       660
     KALRTVPFHY VGVAKEFPTA PKDSFFVANA SYVAQATGSD SVGAFLLDTG GTHQKQIAAH       720
     LRRQLGTSAT VSDLTQTRGT VGSSLTAVDL AGLTRIELAF AVLLAAGAGG LVLALGLAER       780
     RRTFAIATVL GATRRQLRGM VLTEAILLTA GGLAGGALIG WALSEMLVKV LTGVFDPPPA       840
     DLAVPGAYLA LTAFAATVAV LAAALNGVRR AARPAVEELR DL                          882
//

If you have problems or comments...

PBIL Back to PBIL home page