(data stored in ACNUC7421 zone)

EMBL: BA000030.PE14

BA000030.PE14        Location/Qualifiers
FT   CDS             19446..20279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_14"
FT                   /old_locus_tag="SAV_14"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_14"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67723"
FT                   /db_xref="GOA:Q82RX8"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RX8"
FT                   /protein_id="BAC67723.1"
FT                   /translation="MTSQNTTAAPCAPNFLPIRKVQSRTNHVPYLRGNHAGPSPVTHAQ
FT                   TQQKPVGSTMSQQQYPQPQQPGRNGLATTALVLGIIAVVVSFIPVLNVVVWPLAILGIV
FT                   FGAIGLSKAGKVRKGKGAGITGLVTSAVAIIMFFAMNALFFSAVDKASEELDKSYDSTT
FT                   VGDGKSKTGGAKESKVMKDFKVTKCDVVTGDFGIKEMAIHVDYANNGDRRYSYFVEGEV
FT                   LADGKKVDDFMSTAENLAPGQKFTDKNAGALVNADEIKDAKKLECKTINASRTDF"
     MTSQNTTAAP CAPNFLPIRK VQSRTNHVPY LRGNHAGPSP VTHAQTQQKP VGSTMSQQQY        60
     PQPQQPGRNG LATTALVLGI IAVVVSFIPV LNVVVWPLAI LGIVFGAIGL SKAGKVRKGK       120
     GAGITGLVTS AVAIIMFFAM NALFFSAVDK ASEELDKSYD STTVGDGKSK TGGAKESKVM       180
     KDFKVTKCDV VTGDFGIKEM AIHVDYANNG DRRYSYFVEG EVLADGKKVD DFMSTAENLA       240
     PGQKFTDKNA GALVNADEIK DAKKLECKTI NASRTDF                                277
//

If you have problems or comments...

PBIL Back to PBIL home page