(data stored in ACNUC7421 zone)

EMBL: BA000030.PE144

BA000030.PE144       Location/Qualifiers
FT   CDS             complement(162195..163493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_144"
FT                   /old_locus_tag="SAV_144"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_144"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67853"
FT                   /db_xref="GOA:Q82RJ9"
FT                   /db_xref="InterPro:IPR022703"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RJ9"
FT                   /protein_id="BAC67853.1"
FT                   /translation="MSGIHPFRVLRAKPLWIANGVITGVLALLFTVFYVGANIDPVDHM
FT                   KNLPVGLVNADKGAAVGGEQVNLGARITESIKKSTASGGKIDWKVMDEKEMKEELGKGK
FT                   LYGALVVPADFTSATTALTGAATTGVPTRPTLTVLTNQSAGSVGSSLARTATTQAAENA
FT                   SLQVGKELTPQGGTGQAKLPAAARVLLADPAAVAVEDGHPLDSHSGLGLTAFYYALVLV
FT                   VVGMLSANVISGQVDHALGYTHNDMGPLRLHRPLIRATRVQTLAISSTLMAGLSLLMGT
FT                   LVMVGAIGLMGMDAAHLPLLWLFSVCAIAVSGIGALTLLAVFGTPGMLVVTLVFIGMAV
FT                   PTAGATTPLQALPGFYRFLAEFEPLRQITGGIRSILYYDAQADAGLTRGWVMMAVGLTA
FT                   AALFGFGMTGWYDRKGLHRIPAETEPAKTAAPA"
     MSGIHPFRVL RAKPLWIANG VITGVLALLF TVFYVGANID PVDHMKNLPV GLVNADKGAA        60
     VGGEQVNLGA RITESIKKST ASGGKIDWKV MDEKEMKEEL GKGKLYGALV VPADFTSATT       120
     ALTGAATTGV PTRPTLTVLT NQSAGSVGSS LARTATTQAA ENASLQVGKE LTPQGGTGQA       180
     KLPAAARVLL ADPAAVAVED GHPLDSHSGL GLTAFYYALV LVVVGMLSAN VISGQVDHAL       240
     GYTHNDMGPL RLHRPLIRAT RVQTLAISST LMAGLSLLMG TLVMVGAIGL MGMDAAHLPL       300
     LWLFSVCAIA VSGIGALTLL AVFGTPGMLV VTLVFIGMAV PTAGATTPLQ ALPGFYRFLA       360
     EFEPLRQITG GIRSILYYDA QADAGLTRGW VMMAVGLTAA ALFGFGMTGW YDRKGLHRIP       420
     AETEPAKTAA PA                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page