(data stored in ACNUC7421 zone)

EMBL: BA000030.PE147

BA000030.PE147       Location/Qualifiers
FT   CDS             167014..167367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_147"
FT                   /old_locus_tag="SAV_147"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_147"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67856"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RJ6"
FT                   /protein_id="BAC67856.1"
FT                   /translation="MTSKVYWTTAPRSMMKKFGQIMRDLGADREEPGPSEAGEGPETGL
FT                   PDQEITTWVDTTEFGSQKFDALAAHASQGQNIFFLRRSKERFTQLMSVETSVRVLDTTG
FT                   APPPENDLFAGLR"
     MTSKVYWTTA PRSMMKKFGQ IMRDLGADRE EPGPSEAGEG PETGLPDQEI TTWVDTTEFG        60
     SQKFDALAAH ASQGQNIFFL RRSKERFTQL MSVETSVRVL DTTGAPPPEN DLFAGLR          117
//

If you have problems or comments...

PBIL Back to PBIL home page