(data stored in ACNUC7421 zone)

EMBL: BA000030.PE149

BA000030.PE149       Location/Qualifiers
FT   CDS             complement(169217..169735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_149"
FT                   /old_locus_tag="SAV_149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_149"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67858"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RJ4"
FT                   /protein_id="BAC67858.1"
FT                   /translation="MSETLDSAATTIARWRSAEERGDVDAAVACLSPDVVLSSPLTDQF
FT                   RFEGSDQLRDFLTSAFAAVKDVHYHTQTGEGDTYALVYRARVGSQSFEEVQMLRLDNQA
FT                   RITEITLFGRPMPALTALMHLMGPALARQQGRRGLATLMSVSTVPIHAMVSSGDRSMVA
FT                   KTRPAARQP"
     MSETLDSAAT TIARWRSAEE RGDVDAAVAC LSPDVVLSSP LTDQFRFEGS DQLRDFLTSA        60
     FAAVKDVHYH TQTGEGDTYA LVYRARVGSQ SFEEVQMLRL DNQARITEIT LFGRPMPALT       120
     ALMHLMGPAL ARQQGRRGLA TLMSVSTVPI HAMVSSGDRS MVAKTRPAAR QP               172
//

If you have problems or comments...

PBIL Back to PBIL home page