(data stored in ACNUC7421 zone)

EMBL: BA000030.PE157

BA000030.PE157       Location/Qualifiers
FT   CDS             complement(177538..179952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_157"
FT                   /old_locus_tag="SAV_157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_157"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67866"
FT                   /db_xref="GOA:Q82RI6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RI6"
FT                   /protein_id="BAC67866.1"
FT                   /translation="MTQPDRILSDPCGTIVDMVARVEPDLTVEQIRDAVKQAAPSRTAR
FT                   RSLAKTLTADPALLTSRRPEGSRSVERLIHKLLAHGARQVAVPLCAGCGKPEPLPQRRG
FT                   KLRVCAYCDATARAQQQPCADCGLPRVIRYTGRNGEGLCSSCQPKDNIDWAQRICDHIA
FT                   TVDPTVPAETVRQIITTITRGRPHYVRRLAWDLEDRPGMLTGNAGHGTPKVIALIDALR
FT                   DAGAQAIVRPPCPHCGRTSVTLRNTLGDVRVCPTCYNTRKAVNCSRCKRRSPVARRSPD
FT                   GQSICNHCDRTDPINHEECSGCGRLRPIIRRNSPTGPLCDTCYRPPVAICLLCGHARPC
FT                   FGVAGGMPRCENCTRLREPCLDCGRTMPVKARTANGPLCETCFKKNPVSFKACTRCGTV
FT                   ERLRHHGLCHRCACNEELTALLAGPDGAVAAPLMQLHSTLMASNHVRVLDWLQKRNTAV
FT                   SVLREIATAECSLDHESLDARTDKAVEHLRAILVAAGALPRRDEQLVAAERWIAAAVAA
FT                   IADLSDRHTIQAFATWTHLTRLRKYSRRKPITAGQAVSARRSVKAAVGFLAWLRAEGLN
FT                   LEAVGQRDLDRWLEGGPTTRQYARDLVLWAVRTKRATNISIPARLKNSPTQALDEDERR
FT                   EIAHRLLGDDQLDARDRVAGLLSLLYAQPFSVIIRLTADHVVVREKSVLLRLGKEPLEL
FT                   SPELGNLIQQIAADRRRDGQIGQIDAHWLFPGIRPGQHLSHITLAARLKRLGIRSLPSR
FT                   TAAIRDLTAEVPAAVVNRLLGLSTSTATSWAKRTAKTSYAAEIARRSDSDK"
     MTQPDRILSD PCGTIVDMVA RVEPDLTVEQ IRDAVKQAAP SRTARRSLAK TLTADPALLT        60
     SRRPEGSRSV ERLIHKLLAH GARQVAVPLC AGCGKPEPLP QRRGKLRVCA YCDATARAQQ       120
     QPCADCGLPR VIRYTGRNGE GLCSSCQPKD NIDWAQRICD HIATVDPTVP AETVRQIITT       180
     ITRGRPHYVR RLAWDLEDRP GMLTGNAGHG TPKVIALIDA LRDAGAQAIV RPPCPHCGRT       240
     SVTLRNTLGD VRVCPTCYNT RKAVNCSRCK RRSPVARRSP DGQSICNHCD RTDPINHEEC       300
     SGCGRLRPII RRNSPTGPLC DTCYRPPVAI CLLCGHARPC FGVAGGMPRC ENCTRLREPC       360
     LDCGRTMPVK ARTANGPLCE TCFKKNPVSF KACTRCGTVE RLRHHGLCHR CACNEELTAL       420
     LAGPDGAVAA PLMQLHSTLM ASNHVRVLDW LQKRNTAVSV LREIATAECS LDHESLDART       480
     DKAVEHLRAI LVAAGALPRR DEQLVAAERW IAAAVAAIAD LSDRHTIQAF ATWTHLTRLR       540
     KYSRRKPITA GQAVSARRSV KAAVGFLAWL RAEGLNLEAV GQRDLDRWLE GGPTTRQYAR       600
     DLVLWAVRTK RATNISIPAR LKNSPTQALD EDERREIAHR LLGDDQLDAR DRVAGLLSLL       660
     YAQPFSVIIR LTADHVVVRE KSVLLRLGKE PLELSPELGN LIQQIAADRR RDGQIGQIDA       720
     HWLFPGIRPG QHLSHITLAA RLKRLGIRSL PSRTAAIRDL TAEVPAAVVN RLLGLSTSTA       780
     TSWAKRTAKT SYAAEIARRS DSDK                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page