(data stored in ACNUC7421 zone)

EMBL: BA000030.PE158

BA000030.PE158       Location/Qualifiers
FT   CDS             complement(179949..180287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_158"
FT                   /old_locus_tag="SAV_158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_158"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67867"
FT                   /db_xref="GOA:Q82RI5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RI5"
FT                   /protein_id="BAC67867.1"
FT                   /translation="MTAKLDYRWKLREVMATRGMFSTISLQPLLAERGIDLSSSQVYRL
FT                   VTERPERLSLKVLMALLDILDCSMDDLIEPVASASSAAKPKRAVGDADTSVGSFRPKRA
FT                   RIVPRSEP"
     MTAKLDYRWK LREVMATRGM FSTISLQPLL AERGIDLSSS QVYRLVTERP ERLSLKVLMA        60
     LLDILDCSMD DLIEPVASAS SAAKPKRAVG DADTSVGSFR PKRARIVPRS EP               112
//

If you have problems or comments...

PBIL Back to PBIL home page