(data stored in ACNUC7421 zone)

EMBL: BA000030.PE161

BA000030.PE161       Location/Qualifiers
FT   CDS             182430..182948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_161"
FT                   /old_locus_tag="SAV_161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_161"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67870"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RI2"
FT                   /protein_id="BAC67870.1"
FT                   /translation="MTTRLRHIGAAIMGILDPIPSTVPSPMREEEGAWVRAHAWTKGLR
FT                   KIEDAYPCGFHRWCSCERGICPGCASGHHDRCVSAGGPRVDEHADTITDAQGFVVAVIR
FT                   FRPGQRPCRWICPCPHPTAVEETAETGKPEKPPAAQHAVPAQRPAVAPEGQLPLFASGP
FT                   QEHGDGEAP"
     MTTRLRHIGA AIMGILDPIP STVPSPMREE EGAWVRAHAW TKGLRKIEDA YPCGFHRWCS        60
     CERGICPGCA SGHHDRCVSA GGPRVDEHAD TITDAQGFVV AVIRFRPGQR PCRWICPCPH       120
     PTAVEETAET GKPEKPPAAQ HAVPAQRPAV APEGQLPLFA SGPQEHGDGE AP               172
//

If you have problems or comments...

PBIL Back to PBIL home page