(data stored in ACNUC7421 zone)

EMBL: BA000030.PE168

BA000030.PE168       Location/Qualifiers
FT   CDS             188180..189094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_168"
FT                   /old_locus_tag="SAV_168"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_168"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67877"
FT                   /db_xref="InterPro:IPR025855"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RH5"
FT                   /protein_id="BAC67877.1"
FT                   /translation="MNSAAQSIPATAMAPTPAEPLTHQVLAGLAQHRIATTSQMRRMLR
FT                   PDGTRQLMSRVLNRLRSDGFVDCTVLPDANRTRTNAWYLTQEGARLTRDLPVLRGRPPY
FT                   PISSMTAASLKTPHTLAVVRAHLAFAADARRLGHEHGPWDWTPEVSHSIGEGERIVADA
FT                   VMYYTVVESEHRRKLRAFVEVDRSTMSSERLAVKLIEYARLFQYEAQPVGRRRQASVGP
FT                   AWLRWYPVFPRVLFVLTGASRVRLENRMSDLQAMVAQHPLVAGLAREVRLGAAVLEDLE
FT                   QHGPAQDVWMPLVGGNSRPWTDL"
     MNSAAQSIPA TAMAPTPAEP LTHQVLAGLA QHRIATTSQM RRMLRPDGTR QLMSRVLNRL        60
     RSDGFVDCTV LPDANRTRTN AWYLTQEGAR LTRDLPVLRG RPPYPISSMT AASLKTPHTL       120
     AVVRAHLAFA ADARRLGHEH GPWDWTPEVS HSIGEGERIV ADAVMYYTVV ESEHRRKLRA       180
     FVEVDRSTMS SERLAVKLIE YARLFQYEAQ PVGRRRQASV GPAWLRWYPV FPRVLFVLTG       240
     ASRVRLENRM SDLQAMVAQH PLVAGLAREV RLGAAVLEDL EQHGPAQDVW MPLVGGNSRP       300
     WTDL                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page