(data stored in ACNUC7421 zone)

EMBL: BA000030.PE173

BA000030.PE173       Location/Qualifiers
FT   CDS             194571..194891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_173"
FT                   /old_locus_tag="SAV_173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_173"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67882"
FT                   /db_xref="GOA:Q82RH0"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RH0"
FT                   /protein_id="BAC67882.1"
FT                   /translation="MLAGRLDETGDGWINMLESWATKGFKAGLMALVVIGMVQKFSLKA
FT                   GLGALLLMVIALGLYDSRNDLADMFTDEVKNPSKGAPAVPGIVRGPDPLARVHSDGTGD
FT                   GL"
     MLAGRLDETG DGWINMLESW ATKGFKAGLM ALVVIGMVQK FSLKAGLGAL LLMVIALGLY        60
     DSRNDLADMF TDEVKNPSKG APAVPGIVRG PDPLARVHSD GTGDGL                      106
//

If you have problems or comments...

PBIL Back to PBIL home page