(data stored in ACNUC7421 zone)

EMBL: BA000030.PE174

BA000030.PE174       Location/Qualifiers
FT   CDS             194888..195463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_174"
FT                   /old_locus_tag="SAV_174"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_174"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67883"
FT                   /db_xref="GOA:Q82RG9"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RG9"
FT                   /protein_id="BAC67883.1"
FT                   /translation="MSAATMGRVGRFYTSARRHPWVLGKVADWKIPLGPYTPAQIAVAV
FT                   GGGFLLVKTISWWSWMGPVPIVAWVLTVWAVRRPKIKGRAPLQAALGWVLLAWQPQGGR
FT                   MGGRAARDRLSRPLFGGFTLEVAAPAVPVMATLRVDQPAADRKARRGPAVRPSARPRSA
FT                   PQARPVSVGPVSGVQQLLALAEQAGGAR"
     MSAATMGRVG RFYTSARRHP WVLGKVADWK IPLGPYTPAQ IAVAVGGGFL LVKTISWWSW        60
     MGPVPIVAWV LTVWAVRRPK IKGRAPLQAA LGWVLLAWQP QGGRMGGRAA RDRLSRPLFG       120
     GFTLEVAAPA VPVMATLRVD QPAADRKARR GPAVRPSARP RSAPQARPVS VGPVSGVQQL       180
     LALAEQAGGA R                                                            191
//

If you have problems or comments...

PBIL Back to PBIL home page