(data stored in ACNUC7421 zone)

EMBL: BA000030.PE176

BA000030.PE176       Location/Qualifiers
FT   CDS             198138..198488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_176"
FT                   /old_locus_tag="SAV_176"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_176"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67885"
FT                   /db_xref="GOA:Q82RG7"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RG7"
FT                   /protein_id="BAC67885.1"
FT                   /translation="MTSFAPSRSRRLAAAASALTVIAVAVGVLVLALGVSLPEAWWPRT
FT                   GQAFAADAAKAPADPCDRIAGPAKAYCERGRHATSAQAGGDAAAWKLLSAATAIGALVI
FT                   WRRRAHTRQGRA"
     MTSFAPSRSR RLAAAASALT VIAVAVGVLV LALGVSLPEA WWPRTGQAFA ADAAKAPADP        60
     CDRIAGPAKA YCERGRHATS AQAGGDAAAW KLLSAATAIG ALVIWRRRAH TRQGRA           116
//

If you have problems or comments...

PBIL Back to PBIL home page