(data stored in ACNUC7421 zone)

EMBL: BA000030.PE177

BA000030.PE177       Location/Qualifiers
FT   CDS             198490..201222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_177"
FT                   /old_locus_tag="SAV_177"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_177"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67886"
FT                   /db_xref="GOA:Q82RG6"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RG6"
FT                   /protein_id="BAC67886.1"
FT                   /translation="MFRPDRGTLRSVGFVLLVTGVFVMVNSQVVYAASSNSETGDLLTP
FT                   LNITSSEGVPINGYELNAEGGSIVAFKTQALAFALSGLFTLIRMLVGLAGWAIEVAFRF
FT                   PLLKILSRPAQKAADTYDNVVVDTLGLKGLLLAWAFVFAGFMIVRGRVGRGLGEIFLTL
FT                   LIAAFAASAFVRPDTLLAQDGPLGQSQQVAAEVAQQSVNSYDWGGKLASKGPCEGMAGS
FT                   AEITCLEREGEGPVSAAEVARPIQDSITNALIVKPYMLLQYGRILDPAKPADRRAYAVH
FT                   LMWVTGGYKAGAKKDNEDKKDACAKIKGEAKKYCERDTDVVPGNNGSGTLPELTPGGEL
FT                   LDASHAIVTDEDREFYAFLQDMKKTGDVGKSCAAYAEKPTWWRVGGAALLLIATLFICG
FT                   MLLSSAIVLLGTQGICAAAAAAGGVTFIAGMLPGPARQSVWKWLSIWGISALTVVGVCA
FT                   FVPFFGIAVDATITNGPDLMVERILLIDVLAIAGTAGHRRLLTGITSFGRRMAMRMRYA
FT                   KVGGTHMPGDTSELGAALAMNSPAALGGYGGGLRAFTGGGGGRFGLLGTRQRLMGALTS
FT                   LFDGAGMPVDTGRVLADAGAEAGRGLAPLTAAAAVSGAGARLGAKGTHWLLIGRRPDKE
FT                   QLAKWRKPTADGDPDAGGPDGGPDGGSGGGGPRRPGGPPDRYRDEDGQVVDRRTGQVLH
FT                   DQNTDRTLLSTRAHNRLVRLRGYRILNRGGRAAYGTTVGLPANVRRARSGKSQYLLDAR
FT                   QQVQVWGNTVREDGRAWADTGRHVSRVLREHTDDSGGPGPFVTRRLPARPAPAPRPTGS
FT                   SSSPARTRQASPRASASASPASVSTRPSAPPTSPPRLGSGAPRAAAGGRPGRTAPPGDG
FT                   GAEGSASTGNRARMQELMRQAEALREMRARWQVEDGEDG"
     MFRPDRGTLR SVGFVLLVTG VFVMVNSQVV YAASSNSETG DLLTPLNITS SEGVPINGYE        60
     LNAEGGSIVA FKTQALAFAL SGLFTLIRML VGLAGWAIEV AFRFPLLKIL SRPAQKAADT       120
     YDNVVVDTLG LKGLLLAWAF VFAGFMIVRG RVGRGLGEIF LTLLIAAFAA SAFVRPDTLL       180
     AQDGPLGQSQ QVAAEVAQQS VNSYDWGGKL ASKGPCEGMA GSAEITCLER EGEGPVSAAE       240
     VARPIQDSIT NALIVKPYML LQYGRILDPA KPADRRAYAV HLMWVTGGYK AGAKKDNEDK       300
     KDACAKIKGE AKKYCERDTD VVPGNNGSGT LPELTPGGEL LDASHAIVTD EDREFYAFLQ       360
     DMKKTGDVGK SCAAYAEKPT WWRVGGAALL LIATLFICGM LLSSAIVLLG TQGICAAAAA       420
     AGGVTFIAGM LPGPARQSVW KWLSIWGISA LTVVGVCAFV PFFGIAVDAT ITNGPDLMVE       480
     RILLIDVLAI AGTAGHRRLL TGITSFGRRM AMRMRYAKVG GTHMPGDTSE LGAALAMNSP       540
     AALGGYGGGL RAFTGGGGGR FGLLGTRQRL MGALTSLFDG AGMPVDTGRV LADAGAEAGR       600
     GLAPLTAAAA VSGAGARLGA KGTHWLLIGR RPDKEQLAKW RKPTADGDPD AGGPDGGPDG       660
     GSGGGGPRRP GGPPDRYRDE DGQVVDRRTG QVLHDQNTDR TLLSTRAHNR LVRLRGYRIL       720
     NRGGRAAYGT TVGLPANVRR ARSGKSQYLL DARQQVQVWG NTVREDGRAW ADTGRHVSRV       780
     LREHTDDSGG PGPFVTRRLP ARPAPAPRPT GSSSSPARTR QASPRASASA SPASVSTRPS       840
     APPTSPPRLG SGAPRAAAGG RPGRTAPPGD GGAEGSASTG NRARMQELMR QAEALREMRA       900
     RWQVEDGEDG                                                              910
//

If you have problems or comments...

PBIL Back to PBIL home page