(data stored in ACNUC7421 zone)

EMBL: BA000030.PE178

BA000030.PE178       Location/Qualifiers
FT   CDS             201219..202370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_178"
FT                   /old_locus_tag="SAV_178"
FT                   /product="putative NLP/P60-family secreted protein (PgpA
FT                   peptidase)"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_178"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67887"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RG5"
FT                   /protein_id="BAC67887.1"
FT                   /translation="MRTARRRKTQWGCVVVLLLFAAVCCAAPAGNAISAYVALKTGASA
FT                   DGGVAEGGTAADIPPRMLTAYKKAVQQVGKHVPKCQGMRWPILAGIAKVESNHAVGRNI
FT                   ADNGDIRPRIYGVLLNGSGAGGNTTAFPDTDGGKWDGTASGERAVGPFQFLPSTWEGIG
FT                   EDANGDKTADPHNADDAALGAAAYLCGNGRDLTKRAQLKAAILQYNHSNEYVSNVLGWI
FT                   DQYTAAAKDPDLKNVTGKVRTVIEAALSQRGVPYSWGGGNASGRSYGICCSPSGKSGAS
FT                   IKGFDCSGLTLYAYAKAGIQLPRTAAAQAGVGQRIPTSLGSDALNAGDLVFYADAPGHD
FT                   STIYHVGIYVGSGQMVNAARPGTVVRLDAVNAMSGYAGGARLL"
     MRTARRRKTQ WGCVVVLLLF AAVCCAAPAG NAISAYVALK TGASADGGVA EGGTAADIPP        60
     RMLTAYKKAV QQVGKHVPKC QGMRWPILAG IAKVESNHAV GRNIADNGDI RPRIYGVLLN       120
     GSGAGGNTTA FPDTDGGKWD GTASGERAVG PFQFLPSTWE GIGEDANGDK TADPHNADDA       180
     ALGAAAYLCG NGRDLTKRAQ LKAAILQYNH SNEYVSNVLG WIDQYTAAAK DPDLKNVTGK       240
     VRTVIEAALS QRGVPYSWGG GNASGRSYGI CCSPSGKSGA SIKGFDCSGL TLYAYAKAGI       300
     QLPRTAAAQA GVGQRIPTSL GSDALNAGDL VFYADAPGHD STIYHVGIYV GSGQMVNAAR       360
     PGTVVRLDAV NAMSGYAGGA RLL                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page