(data stored in ACNUC7421 zone)

EMBL: BA000030.PE182

BA000030.PE182       Location/Qualifiers
FT   CDS             207837..208697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_182"
FT                   /old_locus_tag="SAV_182"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_182"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67891"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RG1"
FT                   /protein_id="BAC67891.1"
FT                   /translation="MDGHGVDRERSSLLTRRLSLLIGALVLAAAGTAHADDDPDVGAGK
FT                   CQVIKFCVGVGVDDETGGKGTQTGSQGSSGSKTQCKLTKVNPKPPANHPVWNGADPKKS
FT                   DLYFRACTDGGDGFVVVPQGQPAPQVDPQELAQRAVDSMTLLGPDIASPRGAGKYTVGV
FT                   PTWMWVNQSATTFGPNTASASAGGITVTATAKVSKIVWQMGDGASVTCNGPGTPYQASE
FT                   GMAQSPNCGHVYSKSSAGARSGKYPVTATSTWTIDWQGGGAAGQLTEIRQTNVQVAIGE
FT                   LQVVR"
     MDGHGVDRER SSLLTRRLSL LIGALVLAAA GTAHADDDPD VGAGKCQVIK FCVGVGVDDE        60
     TGGKGTQTGS QGSSGSKTQC KLTKVNPKPP ANHPVWNGAD PKKSDLYFRA CTDGGDGFVV       120
     VPQGQPAPQV DPQELAQRAV DSMTLLGPDI ASPRGAGKYT VGVPTWMWVN QSATTFGPNT       180
     ASASAGGITV TATAKVSKIV WQMGDGASVT CNGPGTPYQA SEGMAQSPNC GHVYSKSSAG       240
     ARSGKYPVTA TSTWTIDWQG GGAAGQLTEI RQTNVQVAIG ELQVVR                      286
//

If you have problems or comments...

PBIL Back to PBIL home page