(data stored in ACNUC7421 zone)

EMBL: BA000030.PE184

BA000030.PE184       Location/Qualifiers
FT   CDS             209423..210250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_184"
FT                   /old_locus_tag="SAV_184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_184"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67893"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RF9"
FT                   /protein_id="BAC67893.1"
FT                   /translation="MAVIALAGCSGAPGVTTSALALLLSWPLEQGRKMILAECDPDGGA
FT                   VLHGLLQGTLGDRYGLRNLSVAARKGESGDAFWRQLIDLSSDDGKQESPRDRLLLPGIT
FT                   DPAQAASLVSVWKALAVAFRGIDASQGHDILIDLGRTGAFGPSAVLAEQADAVVVVVRN
FT                   TLRSLQSAQARVAVLEKRVGDVGLIVINEGPYPAGEVQRVLQVPVVATLPYAPKDAQVL
FT                   SDGADQPRHFTKSALMKASRTCSALLVQRAAARRARLDPRAAFVGGGEVTRAR"
     MAVIALAGCS GAPGVTTSAL ALLLSWPLEQ GRKMILAECD PDGGAVLHGL LQGTLGDRYG        60
     LRNLSVAARK GESGDAFWRQ LIDLSSDDGK QESPRDRLLL PGITDPAQAA SLVSVWKALA       120
     VAFRGIDASQ GHDILIDLGR TGAFGPSAVL AEQADAVVVV VRNTLRSLQS AQARVAVLEK       180
     RVGDVGLIVI NEGPYPAGEV QRVLQVPVVA TLPYAPKDAQ VLSDGADQPR HFTKSALMKA       240
     SRTCSALLVQ RAAARRARLD PRAAFVGGGE VTRAR                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page