(data stored in ACNUC7421 zone)

EMBL: BA000030.PE185

BA000030.PE185       Location/Qualifiers
FT   CDS             210240..211733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_185"
FT                   /old_locus_tag="SAV_185"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_185"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67894"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RF8"
FT                   /protein_id="BAC67894.1"
FT                   /translation="MRGKPLHPDPTVAPPPGRPQPAWPHQANGTAAGAASSTHALGTAT
FT                   PQVTVDYQVARHIAGQVAKQREELLKAKPDMDRASEQQRCLDWINEAVALWSDSAAMAP
FT                   QEDEALRRAVYDLLFRAGRLQPYLDDERVEDIIIQGPDEVWLDYGDGERRMVGPIAESE
FT                   DELLELLRELARSSGHNERTISTANPTLALSLQDGSRLQAITGLGPMTYAVIRRHRVSH
FT                   AGLDDLVRLGTIDPILRDFLGACVRAEKNIMIAGKQKAGKTTLLRAMLKEFGPECRFAT
FT                   IQTEDELFAHANGYHRQVVSLVGRESNGEKDVTGRGAGEVTLLDLMHPALRMSLERIVV
FT                   GEVRGPEVVAMMQALTNGSGGNLCTIHARRPDIIFDRIAELYALAQDNLSEQLAYRQTA
FT                   NGLDFIVYVDMTDETQIGGRRHRYVSHVLELTGIGENGRPATNTVFSPGAEFGELRAVP
FT                   RMDPGCVDDLRRVGFDSAQLQQPYGAWQAPLQLKVGVIR"
     MRGKPLHPDP TVAPPPGRPQ PAWPHQANGT AAGAASSTHA LGTATPQVTV DYQVARHIAG        60
     QVAKQREELL KAKPDMDRAS EQQRCLDWIN EAVALWSDSA AMAPQEDEAL RRAVYDLLFR       120
     AGRLQPYLDD ERVEDIIIQG PDEVWLDYGD GERRMVGPIA ESEDELLELL RELARSSGHN       180
     ERTISTANPT LALSLQDGSR LQAITGLGPM TYAVIRRHRV SHAGLDDLVR LGTIDPILRD       240
     FLGACVRAEK NIMIAGKQKA GKTTLLRAML KEFGPECRFA TIQTEDELFA HANGYHRQVV       300
     SLVGRESNGE KDVTGRGAGE VTLLDLMHPA LRMSLERIVV GEVRGPEVVA MMQALTNGSG       360
     GNLCTIHARR PDIIFDRIAE LYALAQDNLS EQLAYRQTAN GLDFIVYVDM TDETQIGGRR       420
     HRYVSHVLEL TGIGENGRPA TNTVFSPGAE FGELRAVPRM DPGCVDDLRR VGFDSAQLQQ       480
     PYGAWQAPLQ LKVGVIR                                                      497
//

If you have problems or comments...

PBIL Back to PBIL home page