(data stored in ACNUC7421 zone)

EMBL: BA000030.PE186

BA000030.PE186       Location/Qualifiers
FT   CDS             211730..212659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_186"
FT                   /old_locus_tag="SAV_186"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_186"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67895"
FT                   /db_xref="GOA:Q82RF7"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RF7"
FT                   /protein_id="BAC67895.1"
FT                   /translation="MTLLWGLLSGMAVIGGLIGVVAGLVGTTAPRRAPLQQRWQALRAG
FT                   KDQGEDVRLRRRTLAALAVVVFVAVWLVSGNFVGGALLGVAVVGVPWLISPAQMAQERI
FT                   GQLEALSEWTQRLAGLLRLGMGLEQAMITSRQGAPDELAPQIVNLSDRLRLGWRPDGAL
FT                   RAFAEELNDVTADKVVAALILSVNDRGPGLAQALEDLAGTVRDEVAKKRAIEADRAKPR
FT                   TTVRWMTVITVGVVVAGFFVPSYTKPYSTLLGQLVLAFLTVGFIGVLALMRQLGAFRRI
FT                   PRFLITDPSSTVRLPLAGDGAGRAGRWP"
     MTLLWGLLSG MAVIGGLIGV VAGLVGTTAP RRAPLQQRWQ ALRAGKDQGE DVRLRRRTLA        60
     ALAVVVFVAV WLVSGNFVGG ALLGVAVVGV PWLISPAQMA QERIGQLEAL SEWTQRLAGL       120
     LRLGMGLEQA MITSRQGAPD ELAPQIVNLS DRLRLGWRPD GALRAFAEEL NDVTADKVVA       180
     ALILSVNDRG PGLAQALEDL AGTVRDEVAK KRAIEADRAK PRTTVRWMTV ITVGVVVAGF       240
     FVPSYTKPYS TLLGQLVLAF LTVGFIGVLA LMRQLGAFRR IPRFLITDPS STVRLPLAGD       300
     GAGRAGRWP                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page