(data stored in ACNUC7421 zone)

EMBL: BA000030.PE19

BA000030.PE19        Location/Qualifiers
FT   CDS             complement(24570..24983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_19"
FT                   /old_locus_tag="SAV_19"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_19"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67728"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RX3"
FT                   /protein_id="BAC67728.1"
FT                   /translation="MNEGGRMSRDTAVAEVGMRGITFPAWHGEHYVTLAEVLVRLGSFG
FT                   LDLTWRIEFDEIVDPRCVEMERRSADAGMDTLTLLSLTTPFLQLIDAEARGFAGDELVL
FT                   VLTEFDSSSWDVRAVDKRVLSELRQHYPGAEDL"
     MNEGGRMSRD TAVAEVGMRG ITFPAWHGEH YVTLAEVLVR LGSFGLDLTW RIEFDEIVDP        60
     RCVEMERRSA DAGMDTLTLL SLTTPFLQLI DAEARGFAGD ELVLVLTEFD SSSWDVRAVD       120
     KRVLSELRQH YPGAEDL                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page