(data stored in ACNUC7421 zone)

EMBL: BA000030.PE193

BA000030.PE193       Location/Qualifiers
FT   CDS             218903..220732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_193"
FT                   /old_locus_tag="SAV_193"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_193"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67902"
FT                   /db_xref="GOA:Q82RF0"
FT                   /db_xref="InterPro:IPR021235"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RF0"
FT                   /protein_id="BAC67902.1"
FT                   /translation="MKSGADSGQQPVKTASQNQLLCLGRAQRLVISAVVLGGLTISGIG
FT                   FAGSYTAVRALALKKGFGNFSYVFPIGIDAGICVLLAMDLLLTWIRIPFPLLRQTAWLL
FT                   TAATIAYNGAAAWPDPLGTAMHAVIPILFVVAVEAARHAIGQIADITADKHMEGIRITR
FT                   WLLSPLPTFLLWRRMKLWELRSYEQVIKLEQERLVYQARLHTRFGRAWRRKAPVESLMP
FT                   LRLARYGVPLTQTAPTGLAAAGIEPVLLPPAPQPQPQAEPADTVGRGTGQVTAAALGNQ
FT                   PAAATGGEYIQALPTDENTRPATPPKAGDPSYPCDPSHAPRKQYERDRTAQQPAGKPNP
FT                   TVVPDHDDSSQPEASDTPETPHHEEALDEEESRAREHSRLSPTYGYRLASAHGPLPSQY
FT                   VLDHHEVTNPEGHPPSLEEPDTSLDSLLPQQPRDSRRDDGRSPEPAATSPVRGTRSEPG
FT                   RTPRATPSAEHRAHSPEPALEETPDAEAGDSSLPDLTAVDHYYLAWNDFQQQHGKEPNG
FT                   TELSAHLAQRGIHDRENHPIKPKTLTRYFLEFRIYDAWATHRARTSRTDSEPVLNDLAY
FT                   QGITAQYNRPIQTTDLEKRLPGFERRWHALSCH"
     MKSGADSGQQ PVKTASQNQL LCLGRAQRLV ISAVVLGGLT ISGIGFAGSY TAVRALALKK        60
     GFGNFSYVFP IGIDAGICVL LAMDLLLTWI RIPFPLLRQT AWLLTAATIA YNGAAAWPDP       120
     LGTAMHAVIP ILFVVAVEAA RHAIGQIADI TADKHMEGIR ITRWLLSPLP TFLLWRRMKL       180
     WELRSYEQVI KLEQERLVYQ ARLHTRFGRA WRRKAPVESL MPLRLARYGV PLTQTAPTGL       240
     AAAGIEPVLL PPAPQPQPQA EPADTVGRGT GQVTAAALGN QPAAATGGEY IQALPTDENT       300
     RPATPPKAGD PSYPCDPSHA PRKQYERDRT AQQPAGKPNP TVVPDHDDSS QPEASDTPET       360
     PHHEEALDEE ESRAREHSRL SPTYGYRLAS AHGPLPSQYV LDHHEVTNPE GHPPSLEEPD       420
     TSLDSLLPQQ PRDSRRDDGR SPEPAATSPV RGTRSEPGRT PRATPSAEHR AHSPEPALEE       480
     TPDAEAGDSS LPDLTAVDHY YLAWNDFQQQ HGKEPNGTEL SAHLAQRGIH DRENHPIKPK       540
     TLTRYFLEFR IYDAWATHRA RTSRTDSEPV LNDLAYQGIT AQYNRPIQTT DLEKRLPGFE       600
     RRWHALSCH                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page