(data stored in ACNUC7421 zone)

EMBL: BA000030.PE195

BA000030.PE195       Location/Qualifiers
FT   CDS             complement(221399..222835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_195"
FT                   /old_locus_tag="SAV_195"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_195"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67904"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RE8"
FT                   /protein_id="BAC67904.1"
FT                   /translation="MQRHRALDAQRRCSASLVNGRLRAGQRKKRRGPVGLGPEIFTFGG
FT                   PESGVEDYRGAVTANVNLAAAMERSGLSQGELASRLNQRIEALTGKLGALSDRHVRHWL
FT                   AGKTRWPHKRQRIVLEAEFGVSAEELGFIPPPRRTPALSEDDDVRRRAFTTATASLTAA
FT                   ALRPAHLSSGASRVGMVDANRLEENFARLVAADAATGLTVGLETRAVAHAQHALDLMAI
FT                   GHASERVRRRLYFLAAAFMGTALWAALDRMETARAGRHLDRGLRLARLSGDAGMEMRMW
FT                   GHAALLHLQQRQFPDALAAAQMGRETQVCRRDPLFRSLAAARLAGVQSGAGERAAAVRT
FT                   LGQAEVAYERATPEQLRPAYMDFYDRAEFEGLAGLVMMRLGRNEESEAHLHRALSGLRP
FT                   DYHRNRVYYTVLLATTQLRQGDADAACATALTKLPDDPDSLSGRTKALFARFDQDLTTE
FT                   AAGAHFVTEWADRYSRGGIA"
     MQRHRALDAQ RRCSASLVNG RLRAGQRKKR RGPVGLGPEI FTFGGPESGV EDYRGAVTAN        60
     VNLAAAMERS GLSQGELASR LNQRIEALTG KLGALSDRHV RHWLAGKTRW PHKRQRIVLE       120
     AEFGVSAEEL GFIPPPRRTP ALSEDDDVRR RAFTTATASL TAAALRPAHL SSGASRVGMV       180
     DANRLEENFA RLVAADAATG LTVGLETRAV AHAQHALDLM AIGHASERVR RRLYFLAAAF       240
     MGTALWAALD RMETARAGRH LDRGLRLARL SGDAGMEMRM WGHAALLHLQ QRQFPDALAA       300
     AQMGRETQVC RRDPLFRSLA AARLAGVQSG AGERAAAVRT LGQAEVAYER ATPEQLRPAY       360
     MDFYDRAEFE GLAGLVMMRL GRNEESEAHL HRALSGLRPD YHRNRVYYTV LLATTQLRQG       420
     DADAACATAL TKLPDDPDSL SGRTKALFAR FDQDLTTEAA GAHFVTEWAD RYSRGGIA         478
//

If you have problems or comments...

PBIL Back to PBIL home page