(data stored in ACNUC7421 zone)

EMBL: BA000030.PE200

BA000030.PE200       Location/Qualifiers
FT   CDS             complement(229825..236937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_200"
FT                   /old_locus_tag="SAV_200"
FT                   /product="putative large secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_200"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67909"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RE3"
FT                   /protein_id="BAC67909.1"
FT                   /translation="MAARRTRFLSAGVAGAVLAGLLSTMSVVAPQQAFATADDPTPVVP
FT                   SQSLGSVPAQQAEEVGKALPDPKWPNAAEATVDLSQAAPGDPGTVTPSPTTTGSENSTQ
FT                   VGDVVDVAPAPDPVGATTQLSAQRRADGDVSPSPSASSSTDASTSPSPEASTSSSPQPP
FT                   DSVTSEPDQDPVSPDQVQVRVLDHQTVEPAGGIGLGLQVNRTDGVNAPGQVQVDVDYSG
FT                   FQYAYGADFASRLRLVKLPACALQTPEAEGCTDREFVPVDNDTATGTLTATVTAAADTE
FT                   VSGASTQLMREASASGASVYTLASGSSSDAGDYRASTLSPTGSWEVSTGSGAFTYNVPI
FT                   QLPKPPMGSAPSLSLSYNSQSVDGRTSASNNQASWAGMGWDLNVGYIERRYRNCSEDGL
FT                   PTIGDMCWDSPNSAKEPSGAVYVINLNGVTSELIQDNTGSGAYHLKNDPGWRVQRLFDG
FT                   YGAGRDGEYWVISTQDGQRYYFGWGRSERTGTATASVFTEPVVGNDTGEPCHDQFPEPC
FT                   TQAWRWSLDRAVDANEVETMYFYDKEYNHYRSVANSDKAREYVSSGYVKEIQYGWSSQI
FT                   PDGKLPAKVELSHVNRCIERVQENDPLRDEPATCPTFDDKPTSYPDVPVDLMCDGTSAD
FT                   YNCAGKTYYPTFFSTDMLWDVKTYVSDQDGTGWDLVEQYQNKYGMPNPDGTIGKTLWLD
FT                   YIQRKTYGDGDDIVLPVINFNRTDLDNKVGSAELNFPRIQEIHGDLGATTKVSYGFANA
FT                   CDIDHLPTQASNTQDCYWQKWTPEGETESKTGWFKKFLVTKVEVDPTVTTNQDGAPVMT
FT                   TSYTYEGGAGWRFTGDPLVKDEDESWSDWRGYQETQVTTGADTGQKTKKYWLYRGLDGD
FT                   RTSKTDTSATKTVTVNDGDGNNYADHAWLAGHTLSTSLRDDTDISHERTYHTYWSHNTA
FT                   QYDGLPDAHFVRESKSTTNTKISGGWREHVVENEYDDSEAASTTFGLPMRTDDWGQSNV
FT                   SDNRCTTYGRAYNTDNYDSTGAQRWTVVQDQVKHYSVGCSSIADSNQDGYTSTLYDNAT
FT                   SIDANKPVDGNATEVRTYTKAGRYRSSWTGYDKAGRIVWSEDGKHNRSTITYSPANTWP
FT                   MNGITSTSPDPDGTATARGPLTFTEWTSRFWATPTTSKDANGNITKVTLDAAGRPVEVW
FT                   KPTETGSSPSMKFSYTIPTSTNSAGVPDSADGYPHVASHTLQSGSTYLVSHAYTDGLGR
FT                   ARETQTPLPSDVDPATKQIVPFRQVAVTRYDSAGQVTGASAVFRNQGTAGSGGPSSPQP
FT                   SDLPSYSDLVLDWAGRTVSSQIQVKGTPQKAGRVDTSYLGDYTSVTPVDSTATDTYTDV
FT                   YGQVSKVVEHTASSAYTTAYGYTAKGELAQITDPRGNNTLYTYDWAAQRKTTDDPDAGL
FT                   SSSEYNENGQVSQTTATTNDVQTVLTYGYDNLSRATSVRSGADELAAWVWDDPAATGGK
FT                   GQITSAVSRDASGNTYTTKTGKFDERGRPLNTTVTLPTTVNGLAGDYTTSVTYDAADHI
FT                   TSVSYPAAGKLAAEKVTTTYDDYGQPTRLTSSLGGTAYIDNTTYDAYGRLVERDYGAEF
FT                   GGNGIQAQRQYGYDDSNGTRWLRSIATTTTINDLVSEAQKDTYLYDNTGKLTELREQAS
FT                   GQTAQSQCLRYDDQSRLTLAYTHTTAGNCADTTKTTSDFKGTSPYQTGYTYDRLGNLQS
FT                   VTDTNSAGAATTRDYLYPGYDDAGTWTTANADQPHGVRKINKVSAGTTTAAGTYTYYAD
FT                   GAMKQRVEGSTTTDYTWSRLGRLATVKTTKTSGSDLTRYTYDASGNLLVRTTPQETVAS
FT                   IGGTELRTTDGISATATRYYSFGATTVAMRTTDGNNTVNGKITYLMGDTQASTQIAVDA
FT                   ATGTATRRRYTPFGDERSGSLPTGTNHGFLGKTEDTNTGLSLLGARAYDPSLGRFLSPD
FT                   PLSTPYDPQNLSAYSYSGNDPINYSDPSGLIKLNSDGTQCSDGWQKCGPGTVGGGGDTP
FT                   TPAPTVQDQLVDLLPREENGWDADRLAQVWVHYGQTTQGGGYWDAPVGDGDRTGMACFG
FT                   RTACSEAFRVWKETHDFAKAKRVAATFCVENPKRCGADNGAYDSMKEASEAVPILLAGE
FT                   MGAAFSKVLKARGCSFKPTTRVLMKDGKTKPLGKIKPGDLVEAADPTSGHHREVREVTA
FT                   VHLNHDDDLVDLSIRGLDGRIQTLHTTARHRIWDDTAQVWEQAGRLITGHKVNTSGNQH
FT                   ATITSVLAQRGAADMYDLTVEGLHTYYVLAGETPVLVHNGSCWSSTNRKTSVKNAFGHW
FT                   KKHKSEFPNLNNAKEYVEAGTDFLRSTDPSVLTRTRANGDVIRFNPATDEFGVMDPSGV
FT                   PRTYFKPDPASHGYPTNLDYFNAQ"
     MAARRTRFLS AGVAGAVLAG LLSTMSVVAP QQAFATADDP TPVVPSQSLG SVPAQQAEEV        60
     GKALPDPKWP NAAEATVDLS QAAPGDPGTV TPSPTTTGSE NSTQVGDVVD VAPAPDPVGA       120
     TTQLSAQRRA DGDVSPSPSA SSSTDASTSP SPEASTSSSP QPPDSVTSEP DQDPVSPDQV       180
     QVRVLDHQTV EPAGGIGLGL QVNRTDGVNA PGQVQVDVDY SGFQYAYGAD FASRLRLVKL       240
     PACALQTPEA EGCTDREFVP VDNDTATGTL TATVTAAADT EVSGASTQLM REASASGASV       300
     YTLASGSSSD AGDYRASTLS PTGSWEVSTG SGAFTYNVPI QLPKPPMGSA PSLSLSYNSQ       360
     SVDGRTSASN NQASWAGMGW DLNVGYIERR YRNCSEDGLP TIGDMCWDSP NSAKEPSGAV       420
     YVINLNGVTS ELIQDNTGSG AYHLKNDPGW RVQRLFDGYG AGRDGEYWVI STQDGQRYYF       480
     GWGRSERTGT ATASVFTEPV VGNDTGEPCH DQFPEPCTQA WRWSLDRAVD ANEVETMYFY       540
     DKEYNHYRSV ANSDKAREYV SSGYVKEIQY GWSSQIPDGK LPAKVELSHV NRCIERVQEN       600
     DPLRDEPATC PTFDDKPTSY PDVPVDLMCD GTSADYNCAG KTYYPTFFST DMLWDVKTYV       660
     SDQDGTGWDL VEQYQNKYGM PNPDGTIGKT LWLDYIQRKT YGDGDDIVLP VINFNRTDLD       720
     NKVGSAELNF PRIQEIHGDL GATTKVSYGF ANACDIDHLP TQASNTQDCY WQKWTPEGET       780
     ESKTGWFKKF LVTKVEVDPT VTTNQDGAPV MTTSYTYEGG AGWRFTGDPL VKDEDESWSD       840
     WRGYQETQVT TGADTGQKTK KYWLYRGLDG DRTSKTDTSA TKTVTVNDGD GNNYADHAWL       900
     AGHTLSTSLR DDTDISHERT YHTYWSHNTA QYDGLPDAHF VRESKSTTNT KISGGWREHV       960
     VENEYDDSEA ASTTFGLPMR TDDWGQSNVS DNRCTTYGRA YNTDNYDSTG AQRWTVVQDQ      1020
     VKHYSVGCSS IADSNQDGYT STLYDNATSI DANKPVDGNA TEVRTYTKAG RYRSSWTGYD      1080
     KAGRIVWSED GKHNRSTITY SPANTWPMNG ITSTSPDPDG TATARGPLTF TEWTSRFWAT      1140
     PTTSKDANGN ITKVTLDAAG RPVEVWKPTE TGSSPSMKFS YTIPTSTNSA GVPDSADGYP      1200
     HVASHTLQSG STYLVSHAYT DGLGRARETQ TPLPSDVDPA TKQIVPFRQV AVTRYDSAGQ      1260
     VTGASAVFRN QGTAGSGGPS SPQPSDLPSY SDLVLDWAGR TVSSQIQVKG TPQKAGRVDT      1320
     SYLGDYTSVT PVDSTATDTY TDVYGQVSKV VEHTASSAYT TAYGYTAKGE LAQITDPRGN      1380
     NTLYTYDWAA QRKTTDDPDA GLSSSEYNEN GQVSQTTATT NDVQTVLTYG YDNLSRATSV      1440
     RSGADELAAW VWDDPAATGG KGQITSAVSR DASGNTYTTK TGKFDERGRP LNTTVTLPTT      1500
     VNGLAGDYTT SVTYDAADHI TSVSYPAAGK LAAEKVTTTY DDYGQPTRLT SSLGGTAYID      1560
     NTTYDAYGRL VERDYGAEFG GNGIQAQRQY GYDDSNGTRW LRSIATTTTI NDLVSEAQKD      1620
     TYLYDNTGKL TELREQASGQ TAQSQCLRYD DQSRLTLAYT HTTAGNCADT TKTTSDFKGT      1680
     SPYQTGYTYD RLGNLQSVTD TNSAGAATTR DYLYPGYDDA GTWTTANADQ PHGVRKINKV      1740
     SAGTTTAAGT YTYYADGAMK QRVEGSTTTD YTWSRLGRLA TVKTTKTSGS DLTRYTYDAS      1800
     GNLLVRTTPQ ETVASIGGTE LRTTDGISAT ATRYYSFGAT TVAMRTTDGN NTVNGKITYL      1860
     MGDTQASTQI AVDAATGTAT RRRYTPFGDE RSGSLPTGTN HGFLGKTEDT NTGLSLLGAR      1920
     AYDPSLGRFL SPDPLSTPYD PQNLSAYSYS GNDPINYSDP SGLIKLNSDG TQCSDGWQKC      1980
     GPGTVGGGGD TPTPAPTVQD QLVDLLPREE NGWDADRLAQ VWVHYGQTTQ GGGYWDAPVG      2040
     DGDRTGMACF GRTACSEAFR VWKETHDFAK AKRVAATFCV ENPKRCGADN GAYDSMKEAS      2100
     EAVPILLAGE MGAAFSKVLK ARGCSFKPTT RVLMKDGKTK PLGKIKPGDL VEAADPTSGH      2160
     HREVREVTAV HLNHDDDLVD LSIRGLDGRI QTLHTTARHR IWDDTAQVWE QAGRLITGHK      2220
     VNTSGNQHAT ITSVLAQRGA ADMYDLTVEG LHTYYVLAGE TPVLVHNGSC WSSTNRKTSV      2280
     KNAFGHWKKH KSEFPNLNNA KEYVEAGTDF LRSTDPSVLT RTRANGDVIR FNPATDEFGV      2340
     MDPSGVPRTY FKPDPASHGY PTNLDYFNAQ                                       2370
//

If you have problems or comments...

PBIL Back to PBIL home page