(data stored in ACNUC7421 zone)

EMBL: BA000030.PE201

BA000030.PE201       Location/Qualifiers
FT   CDS             237437..237682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_201"
FT                   /old_locus_tag="SAV_201"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_201"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67910"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RE2"
FT                   /protein_id="BAC67910.1"
FT                   /translation="MHERVLTDVDPIQETHLSEPGLLVIDVAGMDDETVLAFQNAIAQT
FT                   WATSTADRTTQDPGQPGVRLRLYADLRQVLAPTSPP"
     MHERVLTDVD PIQETHLSEP GLLVIDVAGM DDETVLAFQN AIAQTWATST ADRTTQDPGQ        60
     PGVRLRLYAD LRQVLAPTSP P                                                  81
//

If you have problems or comments...

PBIL Back to PBIL home page