(data stored in ACNUC7421 zone)

EMBL: BA000030.PE202

BA000030.PE202       Location/Qualifiers
FT   CDS             complement(237840..238601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_202"
FT                   /old_locus_tag="SAV_202"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_202"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67911"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RE1"
FT                   /protein_id="BAC67911.1"
FT                   /translation="MVGGQWRGVVERLAQQLGEAQAAGRRVKEAKATAARQSPSSTGLE
FT                   RAEYQRRLRAYVQTPEHKAAGHAIRVAVALMKAHDAALLRSAHTLLARRANGKRPPRRL
FT                   PRPLVLPGGYASQWWISSIDSTYAGIWRAIPSPGPELRLGSTNDPLVQEVAKQARLLQA
FT                   SHVGYRGRDDLYEAFHPDGTREGGEPVAPIRGLSQETSRRANLALGRGNGIRIQPSRME
FT                   EAGQMHTDYFAVWDRSRAYAAAVLALLRARA"
     MVGGQWRGVV ERLAQQLGEA QAAGRRVKEA KATAARQSPS STGLERAEYQ RRLRAYVQTP        60
     EHKAAGHAIR VAVALMKAHD AALLRSAHTL LARRANGKRP PRRLPRPLVL PGGYASQWWI       120
     SSIDSTYAGI WRAIPSPGPE LRLGSTNDPL VQEVAKQARL LQASHVGYRG RDDLYEAFHP       180
     DGTREGGEPV APIRGLSQET SRRANLALGR GNGIRIQPSR MEEAGQMHTD YFAVWDRSRA       240
     YAAAVLALLR ARA                                                          253
//

If you have problems or comments...

PBIL Back to PBIL home page