(data stored in ACNUC7421 zone)

EMBL: BA000030.PE204

BA000030.PE204       Location/Qualifiers
FT   CDS             complement(239788..240234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_204"
FT                   /old_locus_tag="SAV_204"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_204"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67913"
FT                   /db_xref="GOA:Q82RD9"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RD9"
FT                   /protein_id="BAC67913.1"
FT                   /translation="MFNALEVVTTVIIGVMVGVEFSVAFVMNPILNALPEDSGQLGHAH
FT                   GGRMLGAVMPVWYIGSLVLVAVWAIAGWRHHGTGLVVTAGALLMLSVIMSILLLVPINN
FT                   RNKTWTPDNRPADWKQQMNRWERFHYVRVAVIIAAFALLVAALT"
     MFNALEVVTT VIIGVMVGVE FSVAFVMNPI LNALPEDSGQ LGHAHGGRML GAVMPVWYIG        60
     SLVLVAVWAI AGWRHHGTGL VVTAGALLML SVIMSILLLV PINNRNKTWT PDNRPADWKQ       120
     QMNRWERFHY VRVAVIIAAF ALLVAALT                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page