(data stored in ACNUC7421 zone)

EMBL: BA000030.PE210

BA000030.PE210       Location/Qualifiers
FT   CDS             complement(245081..246040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_210"
FT                   /old_locus_tag="SAV_210"
FT                   /product="putative regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_210"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67919"
FT                   /db_xref="GOA:Q82RD3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RD3"
FT                   /protein_id="BAC67919.1"
FT                   /translation="MARPEKDIPAAAPMEVAELARELRALRRSSGLTYKDLSDKSHYSS
FT                   AALSTAASGKTVPKWEVVESFVRGCGFTGDLTTWQRLHKNALARAKTEEAAGKVKVRAA
FT                   EAETGEPDGADERTEVHHPRLLGGLRKPVPAPEAVVPAQPDGLLTLVQQFMDAHMQLDA
FT                   RLPEDPQRVSSLTVDHVHTALALCTTPQDVLSVMRELVADKGLTIGALERRSRKYYPIS
FT                   GATFAHVLNGDELPTTEWLNIFLRACGVDQERTLIWHYTVTRIKIANLRHRKTPPPLTV
FT                   TPVEPSISADYMRRLLVLTVGVMSVLGATVTAVIATIR"
     MARPEKDIPA AAPMEVAELA RELRALRRSS GLTYKDLSDK SHYSSAALST AASGKTVPKW        60
     EVVESFVRGC GFTGDLTTWQ RLHKNALARA KTEEAAGKVK VRAAEAETGE PDGADERTEV       120
     HHPRLLGGLR KPVPAPEAVV PAQPDGLLTL VQQFMDAHMQ LDARLPEDPQ RVSSLTVDHV       180
     HTALALCTTP QDVLSVMREL VADKGLTIGA LERRSRKYYP ISGATFAHVL NGDELPTTEW       240
     LNIFLRACGV DQERTLIWHY TVTRIKIANL RHRKTPPPLT VTPVEPSISA DYMRRLLVLT       300
     VGVMSVLGAT VTAVIATIR                                                    319
//

If you have problems or comments...

PBIL Back to PBIL home page