(data stored in ACNUC7421 zone)

EMBL: BA000030.PE211

BA000030.PE211       Location/Qualifiers
FT   CDS             complement(246027..246653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_211"
FT                   /old_locus_tag="SAV_211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_211"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67920"
FT                   /db_xref="GOA:Q82RD2"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RD2"
FT                   /protein_id="BAC67920.1"
FT                   /translation="MREGCSARGALTHLHLHRDSDEPYEPGVEMSPSSSSRKKRRRLIV
FT                   SAVTANGAGAVAGVAAQAAISDPFFSALVAAFVAGVVGDLLLQVTRTRNGALGDAARPG
FT                   EHGRAGRRELDNGHGGDDRAARHKTGDGNGRASGARPGCTRCTRPSRQDAHPAAPRVSP
FT                   SEAVMTPRHLYHRHLHRGAKRFTRRVHERNARHGLRQPRGTHGAS"
     MREGCSARGA LTHLHLHRDS DEPYEPGVEM SPSSSSRKKR RRLIVSAVTA NGAGAVAGVA        60
     AQAAISDPFF SALVAAFVAG VVGDLLLQVT RTRNGALGDA ARPGEHGRAG RRELDNGHGG       120
     DDRAARHKTG DGNGRASGAR PGCTRCTRPS RQDAHPAAPR VSPSEAVMTP RHLYHRHLHR       180
     GAKRFTRRVH ERNARHGLRQ PRGTHGAS                                          208
//

If you have problems or comments...

PBIL Back to PBIL home page