(data stored in ACNUC7421 zone)

EMBL: BA000030.PE212

BA000030.PE212       Location/Qualifiers
FT   CDS             complement(247471..248142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_212"
FT                   /old_locus_tag="SAV_212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_212"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67921"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RD1"
FT                   /protein_id="BAC67921.1"
FT                   /translation="MTAIDDLLADARIPTTRREGFDVGAALRRLAADAAAAAAKPNPDM
FT                   VRAAQAGQRLSVVCRWILNKPDAADHVDRLAQEPETPADDGHLDVDGALVFACLLYLTE
FT                   HRESAQFWWQLAAGAGHRAAAYCLHLHHLALGEVREARHWLHEVTDDVLDSEAPDSAFL
FT                   ATLEAVAMYVRRTGSSLAGAPTGGLEMEVDRLATAKADSCIIVQRPGRRLADLMHDFTR
FT                   R"
     MTAIDDLLAD ARIPTTRREG FDVGAALRRL AADAAAAAAK PNPDMVRAAQ AGQRLSVVCR        60
     WILNKPDAAD HVDRLAQEPE TPADDGHLDV DGALVFACLL YLTEHRESAQ FWWQLAAGAG       120
     HRAAAYCLHL HHLALGEVRE ARHWLHEVTD DVLDSEAPDS AFLATLEAVA MYVRRTGSSL       180
     AGAPTGGLEM EVDRLATAKA DSCIIVQRPG RRLADLMHDF TRR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page