(data stored in ACNUC7421 zone)

EMBL: BA000030.PE219

BA000030.PE219       Location/Qualifiers
FT   CDS             255674..256570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_219"
FT                   /old_locus_tag="SAV_219"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_219"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67928"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RC4"
FT                   /protein_id="BAC67928.1"
FT                   /translation="MNWALAHRIASIAAVQTHRDLGIDRTQYVHVHRALGAADVIGMAQ
FT                   PMPRLFGVYFSPADKGPAVMLNASLNAITQRHTAAHELGHHRLGHRTAADEELDPALRW
FT                   GNGSWPEEEKTAEAFAAWFLMPLPAVRAALERICGSRPSHPEHVYRVARELGTSYAGTV
FT                   RHLVNLRLLDAGRAGQWSKIAPADLRSSLAAGASLPGQAQVHVITAASAGQTVHADAGD
FT                   VLVLHLDNALFDVLPKGVEPWTSDGTTPLASAVVTDELPPGEQGLIEVAVPTHGAALRL
FT                   TVVREAPRAGVDETWPA"
     MNWALAHRIA SIAAVQTHRD LGIDRTQYVH VHRALGAADV IGMAQPMPRL FGVYFSPADK        60
     GPAVMLNASL NAITQRHTAA HELGHHRLGH RTAADEELDP ALRWGNGSWP EEEKTAEAFA       120
     AWFLMPLPAV RAALERICGS RPSHPEHVYR VARELGTSYA GTVRHLVNLR LLDAGRAGQW       180
     SKIAPADLRS SLAAGASLPG QAQVHVITAA SAGQTVHADA GDVLVLHLDN ALFDVLPKGV       240
     EPWTSDGTTP LASAVVTDEL PPGEQGLIEV AVPTHGAALR LTVVREAPRA GVDETWPA         298
//

If you have problems or comments...

PBIL Back to PBIL home page