(data stored in ACNUC7421 zone)

EMBL: BA000030.PE220

BA000030.PE220       Location/Qualifiers
FT   CDS             256598..257401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_220"
FT                   /old_locus_tag="SAV_220"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_220"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67929"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RC3"
FT                   /protein_id="BAC67929.1"
FT                   /translation="MSGGLMHTFTVTERDVTQAWVAACNKLDRKDNPDRTGLHTVVRIA
FT                   DPTSDDPVFRAELDRLRTARGLWPLETVASTLFPAALAARSADPDDLAERYRRMYPVIK
FT                   RYPGNHRGTYFGRLVFYPAASKTGIDQLSTVISRLRTQAAGTKIAAAYEIDIAAATDQE
FT                   EAGADLLVHTAGKDNSYIGFPCLSHISLQLDRDRRVHAAALYRSHFMFERAYGNYLGLG
FT                   RLLAYIAQQAELACGTLTVMAGHARLDGPVTQLRPLLTGTSRLAA"
     MSGGLMHTFT VTERDVTQAW VAACNKLDRK DNPDRTGLHT VVRIADPTSD DPVFRAELDR        60
     LRTARGLWPL ETVASTLFPA ALAARSADPD DLAERYRRMY PVIKRYPGNH RGTYFGRLVF       120
     YPAASKTGID QLSTVISRLR TQAAGTKIAA AYEIDIAAAT DQEEAGADLL VHTAGKDNSY       180
     IGFPCLSHIS LQLDRDRRVH AAALYRSHFM FERAYGNYLG LGRLLAYIAQ QAELACGTLT       240
     VMAGHARLDG PVTQLRPLLT GTSRLAA                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page