(data stored in ACNUC7421 zone)

EMBL: BA000030.PE224

BA000030.PE224       Location/Qualifiers
FT   CDS             261139..262191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_224"
FT                   /old_locus_tag="SAV_224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_224"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67933"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RB9"
FT                   /protein_id="BAC67933.1"
FT                   /translation="MPRGRPQDLAWRQFVRPAAVPEPVVLAAAYAARMTQEWTSAMSFS
FT                   SFAPPSGGQDEAAPVDPREAVEAVAMRWQAFSSRGAQVGWASQESLRQAGVTGYGPLIN
FT                   RVVEIHGLMGSIGEQLALARAAEQDAQRHQRTAAIHDPRQAAVLEHSRRMAVRALCEMS
FT                   THFVLGAAHGLANLVLRTVLCHPAAAYEVNQAKRLKKAQGFPPGTDLKEAWLTFSPTGD
FT                   VWSTLLPAAAEASGLTSLQDLVARLCLLQVDPRFSALEQRRGMDYHRHRPQSLDHTSPR
FT                   AGLWSYDPVHKVSTMRMPGASADAERDEETVHRISADALECLGAALTDIEPLMGESLRS
FT                   CHLSWIPVNA"
     MPRGRPQDLA WRQFVRPAAV PEPVVLAAAY AARMTQEWTS AMSFSSFAPP SGGQDEAAPV        60
     DPREAVEAVA MRWQAFSSRG AQVGWASQES LRQAGVTGYG PLINRVVEIH GLMGSIGEQL       120
     ALARAAEQDA QRHQRTAAIH DPRQAAVLEH SRRMAVRALC EMSTHFVLGA AHGLANLVLR       180
     TVLCHPAAAY EVNQAKRLKK AQGFPPGTDL KEAWLTFSPT GDVWSTLLPA AAEASGLTSL       240
     QDLVARLCLL QVDPRFSALE QRRGMDYHRH RPQSLDHTSP RAGLWSYDPV HKVSTMRMPG       300
     ASADAERDEE TVHRISADAL ECLGAALTDI EPLMGESLRS CHLSWIPVNA                  350
//

If you have problems or comments...

PBIL Back to PBIL home page