(data stored in ACNUC7421 zone)

EMBL: BA000030.PE230

BA000030.PE230       Location/Qualifiers
FT   CDS             complement(270055..271758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_230"
FT                   /old_locus_tag="SAV_230"
FT                   /product="putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_230"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67939"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RB3"
FT                   /protein_id="BAC67939.1"
FT                   /translation="MPRRSVMATRELRVRRTRSRTRRTAGACLLVAGCVITSSVPSASA
FT                   SPQGGARLCATEPFPPSESTPPPILSGSDVWSFVSDPALHPMRVKVTANKPGTARGDIF
FT                   VAPFSADQMVGQTGALINDNSGDPVWFRPLPSTNLQNADFKVQTYYDGRRDRGQPVLTW
FT                   WQGTLALPPAYTNLPAGAPEQGGCYYIYDRHYRLLKTVFAHHGCYPDEHEFTLTRRGTA
FT                   LFIASKPVPMDLTPYGGPKNGAIENSEIQEVDLATGRLLFSWNALDHLDPADSEEPVSS
FT                   ASSSDGVWDAFHINSVDEGPDGRLLISARNMWAIYDVTKRSGRIRYQIGGRKSDFTFGP
FT                   NADFYWQHDARFRPGNRISMFDDGCCDLPDGTPEQVSHGLILNLDVRSRKATVDRTYYH
FT                   QPPLESPTQGNTQALSNGNEFIGWGQSPYYSEYAGAGNTQGNGLQNLLYDAKLPGSNIS
FT                   YRAFRNEWIGTPYYPPSTAARSDGGHSVVYASWNGSTQTRAWRVLAGSDPHSLSVVVRR
FT                   APRSGFETAITTNAPGPYFQVKALNAQGKVLGTSHVVTLSSRQSTRDTKR"
     MPRRSVMATR ELRVRRTRSR TRRTAGACLL VAGCVITSSV PSASASPQGG ARLCATEPFP        60
     PSESTPPPIL SGSDVWSFVS DPALHPMRVK VTANKPGTAR GDIFVAPFSA DQMVGQTGAL       120
     INDNSGDPVW FRPLPSTNLQ NADFKVQTYY DGRRDRGQPV LTWWQGTLAL PPAYTNLPAG       180
     APEQGGCYYI YDRHYRLLKT VFAHHGCYPD EHEFTLTRRG TALFIASKPV PMDLTPYGGP       240
     KNGAIENSEI QEVDLATGRL LFSWNALDHL DPADSEEPVS SASSSDGVWD AFHINSVDEG       300
     PDGRLLISAR NMWAIYDVTK RSGRIRYQIG GRKSDFTFGP NADFYWQHDA RFRPGNRISM       360
     FDDGCCDLPD GTPEQVSHGL ILNLDVRSRK ATVDRTYYHQ PPLESPTQGN TQALSNGNEF       420
     IGWGQSPYYS EYAGAGNTQG NGLQNLLYDA KLPGSNISYR AFRNEWIGTP YYPPSTAARS       480
     DGGHSVVYAS WNGSTQTRAW RVLAGSDPHS LSVVVRRAPR SGFETAITTN APGPYFQVKA       540
     LNAQGKVLGT SHVVTLSSRQ STRDTKR                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page