(data stored in ACNUC7421 zone)

EMBL: BA000030.PE236

BA000030.PE236       Location/Qualifiers
FT   CDS             275872..276393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_236"
FT                   /old_locus_tag="SAV_236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_236"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67945"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RA7"
FT                   /protein_id="BAC67945.1"
FT                   /translation="MRGSRHEHHATPAWHQTGRPRRHRHRHRRRNRSPHGCSPSNASSR
FT                   TRQAATQHQAVADRTGDATIGPDPEVRPPERPQANQSRGGPGLLLALALPILMRAALFA
FT                   LDAFEDRLFPPPAPADDESLAADTRSLALTTSPPRPARPGSDTARARHCAYDAVGESPA
FT                   GQWHESRLRS"
     MRGSRHEHHA TPAWHQTGRP RRHRHRHRRR NRSPHGCSPS NASSRTRQAA TQHQAVADRT        60
     GDATIGPDPE VRPPERPQAN QSRGGPGLLL ALALPILMRA ALFALDAFED RLFPPPAPAD       120
     DESLAADTRS LALTTSPPRP ARPGSDTARA RHCAYDAVGE SPAGQWHESR LRS              173
//

If you have problems or comments...

PBIL Back to PBIL home page