(data stored in ACNUC7421 zone)

EMBL: BA000030.PE237

BA000030.PE237       Location/Qualifiers
FT   CDS             276877..278016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_237"
FT                   /old_locus_tag="SAV_237"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_237"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67946"
FT                   /db_xref="GOA:Q82RA6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RA6"
FT                   /protein_id="BAC67946.1"
FT                   /translation="MLGRSFEELVGQDFHDLLHRDSYGHATPRTRCQLRDALLAGRTEH
FT                   GDSEWFARGDGTLVRLSWLVAPFSSESEGAGALMLLYGSNRGVSDEGDDEVPAPLTELD
FT                   RLALLAETTTQLTSTLDVDEAMRRLAALTVPRLADWAVIDLLTERDEVRRALVTEHKDG
FT                   ILVGREDLQGPMPPVPEESPMPLSRALRGAASSLAGPATYQGPPDSGIAVEQGRLFSET
FT                   GMHSAVIAPIRGLRDVLGALTLGRSTRPDAFTAADLPLLEDITRRAGLALDNARLYQRQ
FT                   RKVAETMQRHLLPQLPTVPGVGMTARYVPAPHASSVGGDWYDAFALTDNSHALASATLS
FT                   GTTSTPQPAWRRSATCCAPSHGPSPRPRPAPSSPSSTTP"
     MLGRSFEELV GQDFHDLLHR DSYGHATPRT RCQLRDALLA GRTEHGDSEW FARGDGTLVR        60
     LSWLVAPFSS ESEGAGALML LYGSNRGVSD EGDDEVPAPL TELDRLALLA ETTTQLTSTL       120
     DVDEAMRRLA ALTVPRLADW AVIDLLTERD EVRRALVTEH KDGILVGRED LQGPMPPVPE       180
     ESPMPLSRAL RGAASSLAGP ATYQGPPDSG IAVEQGRLFS ETGMHSAVIA PIRGLRDVLG       240
     ALTLGRSTRP DAFTAADLPL LEDITRRAGL ALDNARLYQR QRKVAETMQR HLLPQLPTVP       300
     GVGMTARYVP APHASSVGGD WYDAFALTDN SHALASATLS GTTSTPQPAW RRSATCCAPS       360
     HGPSPRPRPA PSSPSSTTP                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page