(data stored in ACNUC7421 zone)

EMBL: BA000030.PE24

BA000030.PE24        Location/Qualifiers
FT   CDS             complement(30394..31323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_24"
FT                   /old_locus_tag="SAV_24"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_24"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67733"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW8"
FT                   /protein_id="BAC67733.1"
FT                   /translation="MASVSSWPSRTSRRWPVTRWHAVRRRVSGRTRRSSARDCWMWRCP
FT                   RQGCPGGWRWTARTAKRAWSSRRCAASCRTRQHSTSTPTGTRGRGMSGDGKDLKTEGLA
FT                   LIAKGLTEALGELKELGMVGEAGAGRGFGDIALSGLELGHEGLTGEFTSFCERWEWGVR
FT                   SLINEGNGFALKTGLSAGTYYETDKYIEGTFKVVTNAAIGNPYASEENVEKMGWGDIAT
FT                   SGVYGGNVDYSKESFDQAMANSGQAWKDAGRDVMTSHTIGPVPGVNPEELHGAFGVSDD
FT                   EYNQYLDDTFGPSPEARAKAAEQQGGEG"
     MASVSSWPSR TSRRWPVTRW HAVRRRVSGR TRRSSARDCW MWRCPRQGCP GGWRWTARTA        60
     KRAWSSRRCA ASCRTRQHST STPTGTRGRG MSGDGKDLKT EGLALIAKGL TEALGELKEL       120
     GMVGEAGAGR GFGDIALSGL ELGHEGLTGE FTSFCERWEW GVRSLINEGN GFALKTGLSA       180
     GTYYETDKYI EGTFKVVTNA AIGNPYASEE NVEKMGWGDI ATSGVYGGNV DYSKESFDQA       240
     MANSGQAWKD AGRDVMTSHT IGPVPGVNPE ELHGAFGVSD DEYNQYLDDT FGPSPEARAK       300
     AAEQQGGEG                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page