(data stored in ACNUC7421 zone)

EMBL: BA000030.PE25

BA000030.PE25        Location/Qualifiers
FT   CDS             complement(32197..32559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_25"
FT                   /old_locus_tag="SAV_25"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_25"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67734"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:Q82RW7"
FT                   /protein_id="BAC67734.1"
FT                   /translation="MREFPLDKHERTEADDRLDQILATTHAELVDAIATQQDHARTMTL
FT                   IPGSGTAEEPTKTIDRALWSYKEIAAYINVRPDKVRWYRKHGLLPAPDHVEGGKPYWYS
FT                   DTVRAWMASRPSRREP"
     MREFPLDKHE RTEADDRLDQ ILATTHAELV DAIATQQDHA RTMTLIPGSG TAEEPTKTID        60
     RALWSYKEIA AYINVRPDKV RWYRKHGLLP APDHVEGGKP YWYSDTVRAW MASRPSRREP       120
//

If you have problems or comments...

PBIL Back to PBIL home page