(data stored in ACNUC7421 zone)

EMBL: BA000030.PE253

BA000030.PE253       Location/Qualifiers
FT   CDS             294912..295244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_253"
FT                   /old_locus_tag="SAV_253"
FT                   /product="putative MutT-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_253"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67962"
FT                   /db_xref="GOA:Q82R90"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R90"
FT                   /protein_id="BAC67962.1"
FT                   /translation="MPSGKLDQGDPLPAGAARELFEETGITVAPGHLRLVHVVHHRQDD
FT                   EVERIGFFFEATDWQGEPVNREPDKCLALTWFTVHELPDGIIEYPQAGLRGYLDETGPL
FT                   VAHNWE"
     MPSGKLDQGD PLPAGAAREL FEETGITVAP GHLRLVHVVH HRQDDEVERI GFFFEATDWQ        60
     GEPVNREPDK CLALTWFTVH ELPDGIIEYP QAGLRGYLDE TGPLVAHNWE                  110
//

If you have problems or comments...

PBIL Back to PBIL home page