(data stored in ACNUC7421 zone)

EMBL: BA000030.PE259

BA000030.PE259       Location/Qualifiers
FT   CDS             complement(300882..301145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_258"
FT                   /old_locus_tag="SAV_258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_258"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67967"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R85"
FT                   /protein_id="BAC67967.1"
FT                   /translation="MMNFALAPEVSVTDTEHGTVLLDERTGRYWLLNGTGALALRALLD
FT                   GTSPQGVVASLCQRFPDAGTAQVEQDVDNLLHALRTAKVAAS"
     MMNFALAPEV SVTDTEHGTV LLDERTGRYW LLNGTGALAL RALLDGTSPQ GVVASLCQRF        60
     PDAGTAQVEQ DVDNLLHALR TAKVAAS                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page