(data stored in ACNUC7421 zone)

EMBL: BA000030.PE263

BA000030.PE263       Location/Qualifiers
FT   CDS             304104..304334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_261"
FT                   /old_locus_tag="SAV_261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_261"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67970"
FT                   /db_xref="GOA:Q82R82"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R82"
FT                   /protein_id="BAC67970.1"
FT                   /translation="MLGQGQYVPLDLMIEGESQRMSERDALRGLRALMWVVIAIEVPVY
FT                   LVWLVEVSYLTGQQLPRGTEEEDGKPRADTD"
     MLGQGQYVPL DLMIEGESQR MSERDALRGL RALMWVVIAI EVPVYLVWLV EVSYLTGQQL        60
     PRGTEEEDGK PRADTD                                                        76
//

If you have problems or comments...

PBIL Back to PBIL home page