(data stored in ACNUC7421 zone)

EMBL: BA000030.PE266

BA000030.PE266       Location/Qualifiers
FT   CDS             complement(307092..309302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_264"
FT                   /old_locus_tag="SAV_264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_264"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67973"
FT                   /db_xref="GOA:Q82R80"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R80"
FT                   /protein_id="BAC67973.1"
FT                   /translation="MTPATPTPPSSTPPSWPQCGHGTTPEDPAGCRGIRVSGHTACLAH
FT                   LSDADRDAYLAGLSPGNNVDHRGTSFSQDLLDALLDALRDPDTGDPRLGVARFRSATFQ
FT                   RDVGFRSATFQKWADFGSATFQGNAGFRLATFEGDAGFGSARFEGDAGFGSARFEGDAS
FT                   FVSATFEGDASFVSATFEGDASFVSATFQSAASLGWAAFQGDVKFESATFQGDAVFGGA
FT                   DFRGDARFGLAAFERNARFGLARFRGIASFWLVTFHGDAWFRSAIFRGDASFVSATFQS
FT                   DTDLEAATFSDHTRFDRATFFGDARFVEATFRGDTSFVSATLQSNANFLGVTFERDAKF
FT                   ESSIFQGDATFVSATFECDACFEQVGFERSASLGPLVCAGRVKLSGAVFGCPVTLSFAT
FT                   RCLECRRTRWSSTAELRLRYATVDFAHAVFEYPLTIAAEADPFVLHNGRPVAEQSLIDA
FT                   PDIEVRIASLRGVDAAHLVLSDVDLSGCLFTGTVHLDQIRLEGTCSFASVPRRTHWRRW
FT                   RPLRFTQRRALAEEGFWRASQPTPVPGWNAAVAGAVHAGPAQLAPVYRALRKAFEDSRN
FT                   EPGAADFYYGEMEMRRHDRTGSTRTERGLLHGYWLLSGYGLRASRALGWLAAAMLVTIV
FT                   LLMGFGLPKDSPKQVATGTVPPGDGKVTLEIDKADPQNPTGDRFTSERFEKALTGTLNS
FT                   VVFRSSGQDLTTAGTYIEMASRVTEPVLLGLAVLAVRNRVKR"
     MTPATPTPPS STPPSWPQCG HGTTPEDPAG CRGIRVSGHT ACLAHLSDAD RDAYLAGLSP        60
     GNNVDHRGTS FSQDLLDALL DALRDPDTGD PRLGVARFRS ATFQRDVGFR SATFQKWADF       120
     GSATFQGNAG FRLATFEGDA GFGSARFEGD AGFGSARFEG DASFVSATFE GDASFVSATF       180
     EGDASFVSAT FQSAASLGWA AFQGDVKFES ATFQGDAVFG GADFRGDARF GLAAFERNAR       240
     FGLARFRGIA SFWLVTFHGD AWFRSAIFRG DASFVSATFQ SDTDLEAATF SDHTRFDRAT       300
     FFGDARFVEA TFRGDTSFVS ATLQSNANFL GVTFERDAKF ESSIFQGDAT FVSATFECDA       360
     CFEQVGFERS ASLGPLVCAG RVKLSGAVFG CPVTLSFATR CLECRRTRWS STAELRLRYA       420
     TVDFAHAVFE YPLTIAAEAD PFVLHNGRPV AEQSLIDAPD IEVRIASLRG VDAAHLVLSD       480
     VDLSGCLFTG TVHLDQIRLE GTCSFASVPR RTHWRRWRPL RFTQRRALAE EGFWRASQPT       540
     PVPGWNAAVA GAVHAGPAQL APVYRALRKA FEDSRNEPGA ADFYYGEMEM RRHDRTGSTR       600
     TERGLLHGYW LLSGYGLRAS RALGWLAAAM LVTIVLLMGF GLPKDSPKQV ATGTVPPGDG       660
     KVTLEIDKAD PQNPTGDRFT SERFEKALTG TLNSVVFRSS GQDLTTAGTY IEMASRVTEP       720
     VLLGLAVLAV RNRVKR                                                       736
//

If you have problems or comments...

PBIL Back to PBIL home page