(data stored in ACNUC7421 zone)

EMBL: BA000030.PE269

BA000030.PE269       Location/Qualifiers
FT   CDS             311330..311680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_267"
FT                   /old_locus_tag="SAV_267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_267"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67976"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R77"
FT                   /protein_id="BAC67976.1"
FT                   /translation="MLEDPAAHGVDLDCTMVLHELTGDEWPATRAHAEEFVLPHLREHR
FT                   VRLVQVARASRSLEITVIDDSRQPQRIVERGPWALWDEYESGGTVPQQGGIRLCSLHAK
FT                   GNWRMPLSPTTC"
     MLEDPAAHGV DLDCTMVLHE LTGDEWPATR AHAEEFVLPH LREHRVRLVQ VARASRSLEI        60
     TVIDDSRQPQ RIVERGPWAL WDEYESGGTV PQQGGIRLCS LHAKGNWRMP LSPTTC           116
//

If you have problems or comments...

PBIL Back to PBIL home page