(data stored in ACNUC7421 zone)

EMBL: BA000030.PE270

BA000030.PE270       Location/Qualifiers
FT   CDS             complement(312030..312479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_268"
FT                   /old_locus_tag="SAV_268"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_268"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67977"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R76"
FT                   /protein_id="BAC67977.1"
FT                   /translation="MQSAGDVGYEHAQVGEEYWAGLPLPWNESGKDIQITRAKFTHVPK
FT                   GLKVIEYRAFNGDDTDGNVLFARTDGKGSVGDLFKARNYAGHPMTVKAKTGSHVYYVAR
FT                   VKVTGPIHDNLSGCSYWYRQGSTEFQQQLDCSTIVRLGKPLKYEG"
     MQSAGDVGYE HAQVGEEYWA GLPLPWNESG KDIQITRAKF THVPKGLKVI EYRAFNGDDT        60
     DGNVLFARTD GKGSVGDLFK ARNYAGHPMT VKAKTGSHVY YVARVKVTGP IHDNLSGCSY       120
     WYRQGSTEFQ QQLDCSTIVR LGKPLKYEG                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page