(data stored in ACNUC7421 zone)

EMBL: BA000030.PE272

BA000030.PE272       Location/Qualifiers
FT   CDS             315325..315852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_270"
FT                   /old_locus_tag="SAV_270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_270"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67979"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R74"
FT                   /protein_id="BAC67979.1"
FT                   /translation="MRPWRPWSCPYDDLMRQADPKPYWNTNVARHPGILRAVPKTGTAS
FT                   ATAAQPLLDYINRRYPLTQTTPLDANRFRANAVPEAEPGDIIAYDWQNDGEVDHLSLVV
FT                   DIADGQYPEIAEWGVVDWNPLGVINRNATTPYAKRGWTYSEKNHNWLQSVEETRNVSAK
FT                   LIHIDTRNVTTF"
     MRPWRPWSCP YDDLMRQADP KPYWNTNVAR HPGILRAVPK TGTASATAAQ PLLDYINRRY        60
     PLTQTTPLDA NRFRANAVPE AEPGDIIAYD WQNDGEVDHL SLVVDIADGQ YPEIAEWGVV       120
     DWNPLGVINR NATTPYAKRG WTYSEKNHNW LQSVEETRNV SAKLIHIDTR NVTTF            175
//

If you have problems or comments...

PBIL Back to PBIL home page