(data stored in ACNUC7421 zone)

EMBL: BA000030.PE277

BA000030.PE277       Location/Qualifiers
FT   CDS             321655..322395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_275"
FT                   /old_locus_tag="SAV_275"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_275"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67984"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R69"
FT                   /protein_id="BAC67984.1"
FT                   /translation="MAELAYLAGWKHHDLGQEGAAQRYYQVGYQLACEADPHGHAAWMM
FT                   RALAHQALSLKQPHHCVDLVEGALTRGLGHVDGQTEALLYITHARAYAVTDEKSAAARA
FT                   LLAAEDALLRDDVPQPSYSRVSGPAAGSVASHTARTLTDLADLADHAGTEQQHRDALIR
FT                   WDLKKYKRVHALTYADLGDSLAAQARADEAVAAWSQALTLMEGMTSDRTRKAITSLRSP
FT                   LSVYQRRKVPGAVELARRARQALA"
     MAELAYLAGW KHHDLGQEGA AQRYYQVGYQ LACEADPHGH AAWMMRALAH QALSLKQPHH        60
     CVDLVEGALT RGLGHVDGQT EALLYITHAR AYAVTDEKSA AARALLAAED ALLRDDVPQP       120
     SYSRVSGPAA GSVASHTART LTDLADLADH AGTEQQHRDA LIRWDLKKYK RVHALTYADL       180
     GDSLAAQARA DEAVAAWSQA LTLMEGMTSD RTRKAITSLR SPLSVYQRRK VPGAVELARR       240
     ARQALA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page