(data stored in ACNUC7421 zone)

EMBL: BA000030.PE279

BA000030.PE279       Location/Qualifiers
FT   CDS             323014..323400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_277"
FT                   /old_locus_tag="SAV_277"
FT                   /product="putative terminal protein Tpg homolog"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_277"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67986"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R67"
FT                   /protein_id="BAC67986.1"
FT                   /translation="MHALLILHAAGYRWEVVDSLAALRLAVPGRSAAYTARSRVTPLGV
FT                   RESITARDQSSFFAARSFLSSTTCSSSHHAARLLQAQQDGTDEDDLRQIAAEALGEVYF
FT                   RDNGRRAQSLEVKLTDLVDLKFEL"
     MHALLILHAA GYRWEVVDSL AALRLAVPGR SAAYTARSRV TPLGVRESIT ARDQSSFFAA        60
     RSFLSSTTCS SSHHAARLLQ AQQDGTDEDD LRQIAAEALG EVYFRDNGRR AQSLEVKLTD       120
     LVDLKFEL                                                                128
//

If you have problems or comments...

PBIL Back to PBIL home page