(data stored in ACNUC7421 zone)

EMBL: BA000030.PE284

BA000030.PE284       Location/Qualifiers
FT   CDS             complement(326189..326509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_282"
FT                   /old_locus_tag="SAV_282"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_282"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67991"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R62"
FT                   /protein_id="BAC67991.1"
FT                   /translation="MDTARLRSLIDGVLLTQYRRYTEKELPALCERLGLPSPSAGDTKH
FT                   KRLVASLKACPDDRLPDVAEAVLEQEELDQAERMALLASDTKIARLAAPRAPRVVRRPK
FT                   KK"
     MDTARLRSLI DGVLLTQYRR YTEKELPALC ERLGLPSPSA GDTKHKRLVA SLKACPDDRL        60
     PDVAEAVLEQ EELDQAERMA LLASDTKIAR LAAPRAPRVV RRPKKK                      106
//

If you have problems or comments...

PBIL Back to PBIL home page