(data stored in ACNUC7421 zone)

EMBL: BA000030.PE285

BA000030.PE285       Location/Qualifiers
FT   CDS             326629..327654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_283"
FT                   /old_locus_tag="SAV_283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_283"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67992"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R61"
FT                   /protein_id="BAC67992.1"
FT                   /translation="MSHKSIHEHLLISARKWARTAVDAYLEEPIDQDFAVHHMAVAVEH
FT                   ASKAYLASIAPVLLASEKQPSVDDLLVLSGNEDKTKKGRAGLKTIGGEGAILRAAQLLG
FT                   PGHKGPAKLKELRESRNGITHMGWGQPVTECRELLAAGIEHINALLKALSTEPDGFWGT
FT                   HLEACTALVAQAMSEMEIRYHAKLRQARERFAETTRRLSEAEIAELASSLSALPTAHSS
FT                   RSKTEARTVESGSLTHWDHETRAPMSCSTLSARVSCMMCGPARAAMRRARPRRSSAARR
FT                   CEPPPHRARRPGQSDRARTGRRPGTSAERLPGPAHRRRLPRRKGSPRLRRERTQVRGRL
FT                   R"
     MSHKSIHEHL LISARKWART AVDAYLEEPI DQDFAVHHMA VAVEHASKAY LASIAPVLLA        60
     SEKQPSVDDL LVLSGNEDKT KKGRAGLKTI GGEGAILRAA QLLGPGHKGP AKLKELRESR       120
     NGITHMGWGQ PVTECRELLA AGIEHINALL KALSTEPDGF WGTHLEACTA LVAQAMSEME       180
     IRYHAKLRQA RERFAETTRR LSEAEIAELA SSLSALPTAH SSRSKTEART VESGSLTHWD       240
     HETRAPMSCS TLSARVSCMM CGPARAAMRR ARPRRSSAAR RCEPPPHRAR RPGQSDRART       300
     GRRPGTSAER LPGPAHRRRL PRRKGSPRLR RERTQVRGRL R                           341
//

If you have problems or comments...

PBIL Back to PBIL home page