(data stored in ACNUC7421 zone)

EMBL: BA000030.PE288

BA000030.PE288       Location/Qualifiers
FT   CDS             complement(329452..336546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_286"
FT                   /old_locus_tag="SAV_286"
FT                   /product="putative large secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_286"
FT                   /db_xref="EnsemblGenomes-Tr:BAC67995"
FT                   /db_xref="GOA:Q82R58"
FT                   /db_xref="InterPro:IPR003284"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR030934"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR032871"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R58"
FT                   /protein_id="BAC67995.1"
FT                   /translation="MAVRRARLVSVGFAGAVLAGLLSTVSVVSPIQAAAASDDPTPVVP
FT                   SQSLGSVPAQQTEEVGKALPAPKWPSAAEATVDLSEAAAGEPGTVSPEPSASASGGVGD
FT                   GESTQVGEVVEVAPVAEDLGTEAQLSLSRLADESTPSPSPSVSDGSEPSTPPTAEASPS
FT                   PEPSESASDEPIQDPVSPDQVEVRVLDREAVAPAGGIGLGLQVSRTDGVDAPGQVQVDI
FT                   DYSGFKYAYGADFASRLRLVKVPACALQTPDAESCADREFVPVDNDTDSGTLTATVTAA
FT                   ADTGSAGASAQLMREAGSSSASVYAVTSSSSSDAGDYRASTLSPTGSWEVSTGSGSFNY
FT                   SVPIQVPAPPMGSAPSLAMSYDSQSVDGRTSASNNQASWSGMGWDLNVGFIERRYRNCT
FT                   EDGLPTIGDMCWDSPNSAKEPDGAAYVISLNGTTSELIQDNNGSGAYHLKNDPGWRVQR
FT                   LFDGHGAGRNGEYWVISTQDGQRYYFGWGRSERTSTATASVFTVPVVGNDAGEPCHDQF
FT                   PEPCTQAWRWNLDRAVDANEVETMYFYDKEYNHYRSVANTDKAREYVSSGYVKEIQYGW
FT                   SSQITDGKVPAKVELSHVNRCIERVQENDPLRDEPAACPAFDDKPGSYPDVPVDLMCDG
FT                   TSADYNCAGKTYFPTFFSTDMLWDIKTYVSDQDGTGWDLVQQYQNKYGMPNPDGTIGKT
FT                   LWLDYIQRKTYGDGDDIVLPVINFNRTDLDNKVGSAELNFPRIKEIHGDLGATTTVSYG
FT                   FANACDIDHLPAQASNTQDCYWQKWTPEGETDSKTGWFKKFLVTQVQVDPTVTTNQDGA
FT                   PVMTTSYTYEDGAGWHFTNDPLIKDEDESWTDWRGYQEVQVTTGAGAGQKTKKSWLYRG
FT                   LSGDRTSKADASATKTVTVDDGDGNNYTDDSWLSGRILSTSLRDDTGTSHERTYHKYWD
FT                   HNTAQYDGLPDARFVREKETTTNTKVSSGWREHTVETEYDDTEGASTTFGLPMRTDDWG
FT                   QSSVSDNRCTTYGRAYNTDNYDSTGAQRWTVLQDQVKHYSVGCSSIADSKQDGYASTLY
FT                   DNATSVDANKPVDGNPTESRTYTKSGSYRSTWSGYDDAGRVMWSEDGSHNRTLTKYSPA
FT                   NTWPLNGVIVTTPDPDGALPAHTALTSTAWTSRFWGKPTSIQDANGNVTKMSLDAAGRL
FT                   VEVWRPTETGSSPSMKFSYTIPTSTNSAGVPDAVDGYPHVATHVLQSGTTYLSSHAYVD
FT                   GLGRARETQTPMGNGVDAATGNEVPNRQVSVTRYDSAGNVTGTSAVFRNQGTAGSGGPS
FT                   SAKVEDLPSYTDLVLDWAGRAITSRLQVNGASQDAGRVDTTYDGDFTSVKNKVDAAADT
FT                   YTDVYGQVSKVVEHTGSATYTTAYTYTAKDELIKITDPRGNDTSYTYDWAGQRTATDDS
FT                   DAGVSSTEYDKNGQISKITSNGGKTVLDYGYDALGRKTAVRSGDTELAAWTWDGLNITG
FT                   GKGQITSTTSRDTNGNTYTTKTGEFDVRGRPLKTTVTIPDTVKGLAGSYTTGFTYDAAD
FT                   HVTSVAYPAAGGLPAETVNATYDGYGRPLRLQSALQTYIRSTGYDAYDRLTDRSYGVDS
FT                   VLPGIGAAAQRTYSYDDSNGTRELKSVATTTTLNKVVSERQKDTYTYDLAGKLTELREQ
FT                   ASGQTAQSQCFLYDDQARLTNAYTHTTTGICADKTKTASDFKGTAPYQTAYTYDRLGNL
FT                   QSITNTDSAGTATLHDYLYPGYDDTGTWTTANANQPHGVRKIDHKTGSTTTKSDQLYYF
FT                   DDGTMKQRVEPGITTDYTWTPQGQLEAVKTTKSSGSELTRYAYDADGNILVRTTPQETV
FT                   ASIDGMELRTTNGTTVTATRVYASGTATVAMRTTEGTTATNGKVTYLMADTQASTQLAV
FT                   DASTGASTRRRYTPFGDERSGTLPTGTDNGFLGKTEDTSTGLSLLGARAYDPNLGRFLS
FT                   PDPLATPYAPQNLNAYSYATNNPISYSDPSGLCRRDICGDGYPVAGDGERAGYTGQHPG
FT                   EHACTSCNSGNGGYLLAGVVPSDWDKAQEFYDRVAEIIVSWPAGWTDWNYKPHEDPLAD
FT                   LRVGQVVYNACEDVGGCPDGIDPQRDMLNAAVAIELPGTNGRGSSKKAAGPCKCFLAGT
FT                   DILMADGSTKDIEEVELGDKVQATDPKTGETGPREVTRLITTTGDKHFNKLSIATEDGA
FT                   EELTATHEHPFWSPSESAWITAGSLEPGMTLLTDDGDTVIVTGNRAFTQHATTYNLTVN
FT                   DLHTYYALAGTTPVLVHNSSCSTNAQILGDNMTAAGTIRPAETAAHHIVASASPKAASA
FT                   RAKLASVGIDINDADNGVFLPRGSASPNLTGASVHSRIHTNNYYGYVNDMMSGVRTANE
FT                   ARDVLNHIRNQLNAGYWP"
     MAVRRARLVS VGFAGAVLAG LLSTVSVVSP IQAAAASDDP TPVVPSQSLG SVPAQQTEEV        60
     GKALPAPKWP SAAEATVDLS EAAAGEPGTV SPEPSASASG GVGDGESTQV GEVVEVAPVA       120
     EDLGTEAQLS LSRLADESTP SPSPSVSDGS EPSTPPTAEA SPSPEPSESA SDEPIQDPVS       180
     PDQVEVRVLD REAVAPAGGI GLGLQVSRTD GVDAPGQVQV DIDYSGFKYA YGADFASRLR       240
     LVKVPACALQ TPDAESCADR EFVPVDNDTD SGTLTATVTA AADTGSAGAS AQLMREAGSS       300
     SASVYAVTSS SSSDAGDYRA STLSPTGSWE VSTGSGSFNY SVPIQVPAPP MGSAPSLAMS       360
     YDSQSVDGRT SASNNQASWS GMGWDLNVGF IERRYRNCTE DGLPTIGDMC WDSPNSAKEP       420
     DGAAYVISLN GTTSELIQDN NGSGAYHLKN DPGWRVQRLF DGHGAGRNGE YWVISTQDGQ       480
     RYYFGWGRSE RTSTATASVF TVPVVGNDAG EPCHDQFPEP CTQAWRWNLD RAVDANEVET       540
     MYFYDKEYNH YRSVANTDKA REYVSSGYVK EIQYGWSSQI TDGKVPAKVE LSHVNRCIER       600
     VQENDPLRDE PAACPAFDDK PGSYPDVPVD LMCDGTSADY NCAGKTYFPT FFSTDMLWDI       660
     KTYVSDQDGT GWDLVQQYQN KYGMPNPDGT IGKTLWLDYI QRKTYGDGDD IVLPVINFNR       720
     TDLDNKVGSA ELNFPRIKEI HGDLGATTTV SYGFANACDI DHLPAQASNT QDCYWQKWTP       780
     EGETDSKTGW FKKFLVTQVQ VDPTVTTNQD GAPVMTTSYT YEDGAGWHFT NDPLIKDEDE       840
     SWTDWRGYQE VQVTTGAGAG QKTKKSWLYR GLSGDRTSKA DASATKTVTV DDGDGNNYTD       900
     DSWLSGRILS TSLRDDTGTS HERTYHKYWD HNTAQYDGLP DARFVREKET TTNTKVSSGW       960
     REHTVETEYD DTEGASTTFG LPMRTDDWGQ SSVSDNRCTT YGRAYNTDNY DSTGAQRWTV      1020
     LQDQVKHYSV GCSSIADSKQ DGYASTLYDN ATSVDANKPV DGNPTESRTY TKSGSYRSTW      1080
     SGYDDAGRVM WSEDGSHNRT LTKYSPANTW PLNGVIVTTP DPDGALPAHT ALTSTAWTSR      1140
     FWGKPTSIQD ANGNVTKMSL DAAGRLVEVW RPTETGSSPS MKFSYTIPTS TNSAGVPDAV      1200
     DGYPHVATHV LQSGTTYLSS HAYVDGLGRA RETQTPMGNG VDAATGNEVP NRQVSVTRYD      1260
     SAGNVTGTSA VFRNQGTAGS GGPSSAKVED LPSYTDLVLD WAGRAITSRL QVNGASQDAG      1320
     RVDTTYDGDF TSVKNKVDAA ADTYTDVYGQ VSKVVEHTGS ATYTTAYTYT AKDELIKITD      1380
     PRGNDTSYTY DWAGQRTATD DSDAGVSSTE YDKNGQISKI TSNGGKTVLD YGYDALGRKT      1440
     AVRSGDTELA AWTWDGLNIT GGKGQITSTT SRDTNGNTYT TKTGEFDVRG RPLKTTVTIP      1500
     DTVKGLAGSY TTGFTYDAAD HVTSVAYPAA GGLPAETVNA TYDGYGRPLR LQSALQTYIR      1560
     STGYDAYDRL TDRSYGVDSV LPGIGAAAQR TYSYDDSNGT RELKSVATTT TLNKVVSERQ      1620
     KDTYTYDLAG KLTELREQAS GQTAQSQCFL YDDQARLTNA YTHTTTGICA DKTKTASDFK      1680
     GTAPYQTAYT YDRLGNLQSI TNTDSAGTAT LHDYLYPGYD DTGTWTTANA NQPHGVRKID      1740
     HKTGSTTTKS DQLYYFDDGT MKQRVEPGIT TDYTWTPQGQ LEAVKTTKSS GSELTRYAYD      1800
     ADGNILVRTT PQETVASIDG MELRTTNGTT VTATRVYASG TATVAMRTTE GTTATNGKVT      1860
     YLMADTQAST QLAVDASTGA STRRRYTPFG DERSGTLPTG TDNGFLGKTE DTSTGLSLLG      1920
     ARAYDPNLGR FLSPDPLATP YAPQNLNAYS YATNNPISYS DPSGLCRRDI CGDGYPVAGD      1980
     GERAGYTGQH PGEHACTSCN SGNGGYLLAG VVPSDWDKAQ EFYDRVAEII VSWPAGWTDW      2040
     NYKPHEDPLA DLRVGQVVYN ACEDVGGCPD GIDPQRDMLN AAVAIELPGT NGRGSSKKAA      2100
     GPCKCFLAGT DILMADGSTK DIEEVELGDK VQATDPKTGE TGPREVTRLI TTTGDKHFNK      2160
     LSIATEDGAE ELTATHEHPF WSPSESAWIT AGSLEPGMTL LTDDGDTVIV TGNRAFTQHA      2220
     TTYNLTVNDL HTYYALAGTT PVLVHNSSCS TNAQILGDNM TAAGTIRPAE TAAHHIVASA      2280
     SPKAASARAK LASVGIDIND ADNGVFLPRG SASPNLTGAS VHSRIHTNNY YGYVNDMMSG      2340
     VRTANEARDV LNHIRNQLNA GYWP                                             2364
//

If you have problems or comments...

PBIL Back to PBIL home page