(data stored in ACNUC7421 zone)

EMBL: BA000030.PE296

BA000030.PE296       Location/Qualifiers
FT   CDS             complement(345361..345771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SAVERM_294"
FT                   /old_locus_tag="SAV_294"
FT                   /product="putative invasion protein"
FT                   /db_xref="EnsemblGenomes-Gn:SAVERM_294"
FT                   /db_xref="EnsemblGenomes-Tr:BAC68003"
FT                   /db_xref="GOA:Q82R50"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:Q82R50"
FT                   /protein_id="BAC68003.1"
FT                   /translation="MPDPSHNSLVTPPRRRHPGSTLMILTITLACLIALIFGASGVLNT
FT                   LALPKARELAAETGFSVAAYRRIGVLQLAGVAGVVLGLAVPPLGGLAGAGLLLLLAGAV
FT                   VVHLRQGDPVAKLVPAAVCAVLVASYLAALFA"
     MPDPSHNSLV TPPRRRHPGS TLMILTITLA CLIALIFGAS GVLNTLALPK ARELAAETGF        60
     SVAAYRRIGV LQLAGVAGVV LGLAVPPLGG LAGAGLLLLL AGAVVVHLRQ GDPVAKLVPA       120
     AVCAVLVASY LAALFA                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page